Property Summary

NCBI Gene PubMed Count 36
PubMed Score 166.99
PubTator Score 80.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 3.800 1.9e-04
autosomal dominant Emery-Dreifuss muscul... 1.718 1.7e-03
Breast cancer -4.000 2.4e-02
breast carcinoma -1.900 7.9e-20
colon cancer -1.300 6.3e-03
cystic fibrosis -1.014 9.0e-05
dermatomyositis 1.100 2.3e-02
Duchenne muscular dystrophy 1.278 3.0e-07
ductal carcinoma in situ -2.200 1.8e-04
glioblastoma multiforme 2.400 8.3e-09
head and neck cancer -1.800 2.6e-02
intraductal papillary-mucinous adenoma (... -1.100 3.8e-02
intraductal papillary-mucinous carcinoma... -1.100 4.4e-02
invasive ductal carcinoma -2.900 9.8e-03
juvenile dermatomyositis 1.390 8.9e-11
lung cancer -2.000 1.5e-04
lung carcinoma -1.200 2.8e-11
non-small cell lung cancer -1.100 2.1e-05
ovarian cancer -5.000 3.4e-16
primary Sjogren syndrome 1.600 2.0e-03
psoriasis -2.000 8.8e-08

Gene RIF (18)

AA Sequence

MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHH      1 - 70
HHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPT     71 - 140
GAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHN    141 - 210
YLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATL    211 - 280
QQTGDSIANEDSHDSDHSSEHAHL                                                  281 - 304
//

Text Mined References (38)

PMID Year Title