Property Summary

NCBI Gene PubMed Count 30
Grant Count 23
R01 Count 20
Funding $2,208,575.91
PubMed Score 155.58
PubTator Score 80.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Gene RIF (16)

PMID Text
26428460 Genetic variation in MEOX2, but not TCF15, is a strong predictor of CHD. Further experimental studies should elucidate the underlying molecular mechanisms.
26041434 3D topography transiently induces concomitant upregulation of IL-1beta and MAPK ERK1/2 through nuclear factor-kappaB-dependent signaling pathway.
25561514 Microarray profiling on freshly isolated ECs had a genetic signature for microvascular heart ECs and identified Meox2/Tcf15 heterodimers as novel transcriptional determinants. This signature was similar in skeletal muscle and adipose tissue endothelium.
25460568 MEOX2 participates in chemoresistance irrespective of high CNV, but it is significantly dependent upon H3K27me3 enrichment probably associated with aggressiveness and chemotherapy failure in NSCLC patients
22644917 downregulated expression of GAX is an independent prognostic factor and is correlated with poor survival in hepatocellular carcinoma patients
22206000 MEOX1 and MEOX2 activate p16(INK4a) in a DNA binding dependent manner, whereas they induce p21(CIP1/WAF1) in a DNA binding independent manner.
20421348 Report of an interaction between a homeobox protein and IkappaBbeta in endothelial cells and suggest that MEOX2 modulates the activity of the RelA complex through direct interaction with its components.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19760604 Loss of MEOX2 gene is associated with Wilms tumor.
19383287 ectopic Meox2 suppressed epithelial cell proliferation in cooperation with TGF-beta1, and mediated induction of the cell cycle inhibitor gene p21.
More...

AA Sequence

MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHH      1 - 70
HHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPT     71 - 140
GAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHN    141 - 210
YLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATL    211 - 280
QQTGDSIANEDSHDSDHSSEHAHL                                                  281 - 304
//

Text Mined References (32)

PMID Year Title
26428460 2015 Coronary risk in relation to genetic variation in MEOX2 and TCF15 in a Flemish population.
26041434 2015 Activation of Transcription Factor GAX and Concomitant Downregulation of IL-1? and ERK1/2 Modulate Vascular Smooth Muscle Cell Phenotype in 3D Fibrous Scaffolds.
25561514 2015 Meox2/Tcf15 heterodimers program the heart capillary endothelium for cardiac fatty acid uptake.
25460568 2014 Overexpression of MEOX2 and TWIST1 is associated with H3K27me3 levels and determines lung cancer chemoresistance and prognosis.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
22644917 2012 Growth arrest-specific homeobox is associated with poor survival in patients with hepatocellular carcinoma.
22206000 2011 Mechanisms of MEOX1 and MEOX2 regulation of the cyclin dependent kinase inhibitors p21 and p16 in vascular endothelial cells.
22166940 2012 A genome-wide study reveals rare CNVs exclusive to extreme phenotypes of Alzheimer disease.
20516212 2010 Regulation of the expression and activity of the antiangiogenic homeobox gene GAX/MEOX2 by ZEB2 and microRNA-221.
20421348 2010 MEOX2 regulates nuclear factor-kappaB activity in vascular endothelial cells through interactions with p65 and IkappaBbeta.
More...