Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.37
PubTator Score 17.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (4)

PMID Text
24073994 The G > A p.Q84X mutation in the MEOX1 is identified in Klippel-Feil syndrome.
23290072 We describe a multiplex consanguineous family in which isolated KFS maps to a single 17q21.31 locus that harbors a homozygous frameshift deletion in MEOX1; this deletion results in complete instability of the transcript
22567123 The results demonstrate that MEOX1 is a critical target gene and cofactor of PBX1 in ovarian cancers.
17764081 No mutations were identified in the PAX1 and MEOX1 exons or flanking intronic sequences, excluding them as likely causative genes for diaphanospondylodysostosis

AA Sequence

MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAAT      1 - 70
PHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGST     71 - 140
ANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDL    141 - 210
SERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE                              211 - 254
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24073994 2013 Mutation in MEOX1 gene causes a recessive Klippel-Feil syndrome subtype.
23290072 2013 Mutations in MEOX1, encoding mesenchyme homeobox 1, cause Klippel-Feil anomaly.
22567123 2012 Identification of PBX1 target genes in cancer cells by global mapping of PBX1 binding sites.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17764081 2007 Diaphanospondylodysostosis: six new cases and exclusion of the candidate genes, PAX1 and MEOX1.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16582099 2006 The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
15793308 2005 Hedgehog signaling induces cardiomyogenesis in P19 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...