Property Summary

NCBI Gene PubMed Count 20
PubMed Score 25.69
PubTator Score 6.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.300 7.1e-03
astrocytic glioma -1.400 1.6e-02
Astrocytoma, Pilocytic -1.100 1.5e-07
Atopic dermatitis 1.100 9.2e-05
atypical teratoid / rhabdoid tumor -1.600 1.3e-05
colon cancer -1.100 8.8e-03
ependymoma -1.200 7.6e-12
glioblastoma -1.300 2.3e-08
group 3 medulloblastoma -1.400 2.4e-05
medulloblastoma, large-cell -1.700 2.9e-06
Multiple myeloma 1.456 9.8e-03
ovarian cancer 1.700 6.8e-04
pituitary cancer 1.100 2.6e-07
primitive neuroectodermal tumor -1.500 1.1e-05
psoriasis 1.600 3.7e-09

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGDGIGPEISAAVMKIFDAAKAPIQWEERNVTA      1 - 70
IQGPGGKWMIPSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDV     71 - 140
NIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANIMRMSDGL    141 - 210
FLQKCREVAESCKDIKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGA    211 - 280
NGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAK    281 - 350
CSDFTEEICRRVKDLD                                                          351 - 366
//

Text Mined References (25)

PMID Year Title