Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.62
PubTator Score 1.15

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P50151 Q3B7K2 Q4VC27
Symbols

Gene

Gene RIF (1)

PMID Text
20424519 GNG10 mutations are associated with melanoma.

AA Sequence

MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL        1 - 68
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20424519 2010 Novel somatic mutations in heterotrimeric G proteins in melanoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12626323 2003 Glucagon and regulation of glucose metabolism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...