Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.62
PubTator Score 1.15

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL        1 - 68
//

Text Mined References (11)

PMID Year Title