Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.45
PubTator Score 1.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Astrocytoma, Pilocytic -1.400 3.0e-03
atypical teratoid / rhabdoid tumor -2.900 8.1e-04
Breast cancer 1.500 2.6e-03
cystic fibrosis 1.100 9.7e-04
ependymoma -1.200 1.0e-03
glioblastoma 1.100 3.3e-02
group 3 medulloblastoma 2.100 4.7e-03
lung adenocarcinoma 1.200 2.1e-07
lung cancer 2.500 3.0e-05
lung carcinoma 4.800 1.8e-63
malignant mesothelioma -1.900 2.0e-05
medulloblastoma, large-cell 2.600 5.0e-05
non-small cell lung cancer 1.001 8.6e-06
oligodendroglioma 1.100 1.9e-02
osteosarcoma 1.458 3.3e-03
ovarian cancer -1.200 2.5e-03
Pick disease -1.100 3.0e-03
pituitary cancer -1.100 5.0e-04
primitive neuroectodermal tumor 2.100 2.4e-03
tuberculosis -1.100 2.3e-06

Protein-protein Interaction (11)

AA Sequence

MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKF      1 - 70
FCTIL                                                                      71 - 75
//

Text Mined References (15)

PMID Year Title