Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.90
PubTator Score 1.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
oligodendroglioma 1.100 0.019
glioblastoma multiforme -1.200 0.000
osteosarcoma 2.322 0.001
ependymoma -1.200 0.001
medulloblastoma 2.300 0.001
atypical teratoid / rhabdoid tumor -2.900 0.001
medulloblastoma, large-cell 2.600 0.000
primitive neuroectodermal tumor 2.100 0.002
tuberculosis -1.100 0.000
non-small cell lung cancer 1.001 0.000
lung cancer 4.600 0.000
cystic fibrosis 1.100 0.001
lung adenocarcinoma 1.200 0.000
pilocytic astrocytoma -1.400 0.003
lung carcinoma 4.800 0.000
Pick disease -1.100 0.003
ovarian cancer -1.200 0.002
Breast cancer 1.500 0.003
pituitary cancer -1.100 0.000

Synonym

Accession P50150
Symbols

Gene

AA Sequence

MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKF      1 - 70
FCTIL                                                                      71 - 75
//

Text Mined References (15)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23021213 2012 TREK-1 and Best1 channels mediate fast and slow glutamate release in astrocytes upon GPCR activation.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15824735 2005 Identification of novel VHL target genes and relationship to hypoxic response pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12626323 2003 Glucagon and regulation of glucose metabolism.
12486123 2003 Activation of heterotrimeric G proteins by a high energy phosphate transfer via nucleoside diphosphate kinase (NDPK) B and Gbeta subunits. Complex formation of NDPK B with Gbeta gamma dimers and phosphorylation of His-266 IN Gbeta.
More...