Property Summary

NCBI Gene PubMed Count 210
PubMed Score 514.48
PubTator Score 265.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cancer 2499 4.243 2.1
Mongolian spot 4 3.625 1.8
Impotence 42 3.423 1.7
Disease Target Count
Familial multiple nevi flammei 1

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -1.100 9.1e-03
atypical teratoid / rhabdoid tumor -1.700 5.6e-06
Breast cancer 2.800 2.7e-02
colon cancer -1.400 3.8e-04
Crohn's disease -1.142 7.5e-03
ependymoma -1.100 2.5e-07
glioblastoma -1.200 3.1e-04
group 4 medulloblastoma -1.200 7.2e-03
intraductal papillary-mucinous adenoma (... 1.400 1.2e-03
intraductal papillary-mucinous carcinoma... 1.200 6.1e-03
intraductal papillary-mucinous neoplasm ... 1.600 1.1e-02
juvenile dermatomyositis 1.024 1.6e-09
lung adenocarcinoma -1.200 1.2e-18
lung cancer -2.600 5.8e-06
medulloblastoma, large-cell -1.900 1.9e-05
non-small cell lung cancer -1.169 5.5e-21
osteosarcoma 4.141 4.0e-12
ovarian cancer -1.400 6.6e-06
pancreatic cancer 1.100 1.7e-02
Pick disease -1.100 1.4e-04
progressive supranuclear palsy -1.200 1.2e-02
psoriasis -1.600 9.9e-05
Rheumatoid arthritis 2.000 2.3e-03
tuberculosis 1.200 1.6e-06
ulcerative colitis -1.445 8.6e-03

 GWAS Trait (1)

Gene RIF (147)

AA Sequence

MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDE      1 - 70
DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPG     71 - 140
IQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQR    141 - 210
SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE    211 - 280
EKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ    281 - 350
LNLKEYNLV                                                                 351 - 359
//

Text Mined References (216)

PMID Year Title