Property Summary

NCBI Gene PubMed Count 58
PubMed Score 712.71
PubTator Score 375.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
lung carcinoma 2844 1.29174207272347E-30
non-small cell lung cancer 2798 6.20909330556168E-17
juvenile dermatomyositis 1189 9.31440345566841E-10
atypical teratoid / rhabdoid tumor 4369 1.76564901423637E-9
ovarian cancer 8492 1.04445705556598E-8
medulloblastoma, large-cell 6234 2.20903633456551E-8
oligodendroglioma 2849 4.9097525911651E-8
Duchenne muscular dystrophy 602 8.02965586829705E-8
pilocytic astrocytoma 3086 2.44322882860396E-6
posterior fossa group B ependymoma 1530 5.0742975674902E-6
medulloblastoma 1524 1.37465802526524E-5
lung cancer 4473 1.67087328558074E-5
Breast cancer 3099 2.7759934162511E-5
tuberculosis 1563 1.47993372038553E-4
glioblastoma 5572 1.55132444305966E-4
malignant mesothelioma 3163 3.5233313735847E-4
invasive ductal carcinoma 2950 3.6754002664882E-4
interstitial cystitis 2299 4.2155982125792E-4
pediatric high grade glioma 2712 0.00140823473976983
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00325556866032806
subependymal giant cell astrocytoma 2287 0.00551695292091817
ductal carcinoma in situ 1745 0.00579285357793463
active ulcerative colitis 477 0.00728707078856269
adrenocortical carcinoma 1427 0.0132901111637968
astrocytoma 1493 0.0183238209268392
primitive neuroectodermal tumor 3031 0.0261153969850018
Polycystic Ovary Syndrome 335 0.0343713144259556
cystic fibrosis 1670 0.0344350753569971
Gaucher disease type 3 76 0.0428557159430427
Disease Target Count Z-score Confidence
Asthma 349 3.014 1.5
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0
Disease Target Count Z-score Confidence
Cortical blindness 15 3.348 1.7
Arthus reaction 8 3.255 1.6
Cancer 2346 3.161 1.6
Disease Target Count
Asthma, susceptibility to 11
Rhinitis 46

Expression

Synonym

Accession P50135 B2R9J3 Q546Z6 Q7Z7I2 Q8IU56 Q8WW98 Q9BRW6 HMT
Symbols HMT
MRT51
HNMT-S1
HNMT-S2

Gene

PDB

1ICZ   1JQD   1JQE   2AOT   2AOU   2AOV   2AOW   2AOX  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (58)

PMID Text
26206890 HNMT is identified as a novel gene responsible for intellectual disability. The consequences of the identified missense mutations on the protein function are discussed.
25909280 HRH1-17 TT and HNMT-1639 TT genotypes were associated with the allergic asthma phenotype among African-American children and that the ABP 4107 GG genotype was associated with nonallergic asthma among white children.
25768024 results suggest that the heterozygous Thr/Ile genotype at the HNMT-Thr105Ile locus and the minor Ile105 allele protect against Parkinson's disease and schizophrenia in Han Chinese.
24835231 The polymorphisms of HNMT and HRH3 were irrelevant with breast cancer in the present study.
23932992 The A939G HNMT polymorphism is associated with autoimmune MG, while no association with C314T SNP was found.
21794955 The results of this study indicated that Histamine N-methyltransferase Thr105Ile polymorphism is associated Parkinson's disease.
21138759 Lack of the association of HNMT Thr105Ile functional polymorphism with Alzheimer's disease is found.
21040557 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20551163 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQI      1 - 70
LSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIH     71 - 140
MIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDN    141 - 210
LGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVL    211 - 280
FNNTLSFIVIEA                                                              281 - 292
//

Text Mined References (61)

PMID Year Title
26206890 2015 Mutations in the histamine N-methyltransferase gene, HNMT, are associated with nonsyndromic autosomal recessive intellectual disability.
25909280 2015 Genetic Variation along the Histamine Pathway in Children with Allergic versus Nonallergic Asthma.
25768024 2015 Association of histamine N-methyltransferase Thr105Ile polymorphism with Parkinson's disease and schizophrenia in Han Chinese: a case-control study.
24835231 2014 Associations of polymorphisms in histidine decarboxylase, histamine N-methyltransferase and histamine receptor H3 genes with breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23932992 2013 Association of myasthenia gravis with polymorphisms in the gene of histamine N-methyltransferase.
21794955 2012 Histamine N-methyltransferase Thr105Ile polymorphism is associated with Parkinson's disease.
21269460 2011 Initial characterization of the human central proteome.
21138759 2011 No association between histamine N-methyltransferase functional polymorphism Thr105Ile and Alzheimer's disease.
More...