Property Summary

Ligand Count 2
NCBI Gene PubMed Count 61
PubMed Score 757.54
PubTator Score 375.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Asthma 385 0.0 3.0
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Disease Target Count Z-score Confidence
Cortical blindness 16 3.269 1.6
Cancer 2499 3.241 1.6
Arthus reaction 7 3.229 1.6
Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (29)

Disease log2 FC p
active ulcerative colitis -1.340 7.3e-03
adrenocortical carcinoma -1.552 1.3e-02
adult high grade glioma 1.300 6.7e-03
astrocytoma 1.900 6.8e-23
Astrocytoma, Pilocytic 1.900 1.6e-06
atypical teratoid / rhabdoid tumor -2.100 5.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.185 3.3e-03
Breast cancer -1.100 2.8e-05
cystic fibrosis 1.200 3.4e-02
Duchenne muscular dystrophy 1.661 8.0e-08
ductal carcinoma in situ -1.300 5.8e-03
ependymoma 1.300 7.1e-04
Gaucher disease type 3 -1.100 4.3e-02
glioblastoma 1.300 5.9e-05
group 3 medulloblastoma -1.900 4.7e-03
interstitial cystitis -1.400 4.2e-04
invasive ductal carcinoma -1.200 6.7e-04
juvenile dermatomyositis 1.422 9.3e-10
lung cancer -1.700 1.8e-03
lung carcinoma -2.200 1.3e-30
malignant mesothelioma 1.500 3.5e-04
medulloblastoma, large-cell -3.000 2.7e-05
non-small cell lung cancer -1.428 2.0e-10
oligodendroglioma 1.500 4.9e-08
ovarian cancer -3.300 1.0e-08
Polycystic ovary syndrome 1.106 3.4e-02
primitive neuroectodermal tumor -1.200 2.6e-02
subependymal giant cell astrocytoma 1.623 5.5e-03
tuberculosis 1.200 1.5e-04

Gene RIF (61)

AA Sequence

MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQI      1 - 70
LSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIH     71 - 140
MIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDN    141 - 210
LGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVL    211 - 280
FNNTLSFIVIEA                                                              281 - 292
//

Text Mined References (64)

PMID Year Title