Property Summary

NCBI Gene PubMed Count 27
PubMed Score 120.91
PubTator Score 62.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.3e-13
active ulcerative colitis 764 3.1e-02

Expression

  Differential Expression (2)

Disease log2 FC p
active ulcerative colitis -1.045 3.1e-02
psoriasis -1.700 5.3e-13

Synonym

Accession P50120 A8K7G3 Q6ISQ9 Q6ISS7
Symbols CRBP2
RBPC2
CRBPII
CRABP-II

Gene

PDB

2RCQ   2RCT   4EDE   4EEJ   4EFG   4EXZ   4GKC   4QYN   4QYP   4QZT   4QZU   4RUU   4ZCB   4ZGU   4ZH6   4ZH9   4ZJ0   4ZR2   5DG4   5DPQ   5F58   5F6B   5F7G   5FAZ   5FEN   5FFH   5U6G  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

AA Sequence

MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVE      1 - 70
FDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK           71 - 134
//

Text Mined References (28)

PMID Year Title