Property Summary

NCBI Gene PubMed Count 24
Grant Count 62
R01 Count 51
Funding $10,428,340.88
PubMed Score 117.55
PubTator Score 62.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
psoriasis 6,685
ulcerative colitis 2,087

Expression

  Differential Expression (2)

Disease log2 FC p
ulcerative colitis -1.200 0.000
psoriasis -1.700 0.000

Synonym

Accession P50120 A8K7G3 Q6ISQ9 Q6ISS7
Symbols CRBP2
RBPC2
CRBPII
CRABP-II

Gene

PDB

2RCQ   2RCT   4EDE   4EEJ   4EFG   4EXZ   4GKC   4QYN   4QYP   4QZT   4QZU   4RUU   4ZCB   4ZGU   4ZH6   4ZH9   4ZJ0   4ZR2   5DG4   5DPQ  

Gene RIF (10)

PMID Text
27008505 promotes overexpression and activation of BCL2 in acute lymphoblastic leukemia development and progression
26264242 RBP2 could induce epithelial-mesenchymal transition in esophageal cancer cells and exert a greater effect on the expression of E-cadherin in lung squamous cells than in esophageal squamous cells.
25478840 The structure of retinal-bound human CRBPII and the structure of retinol-bound CRBPII with retinol fully occupying the binding pocket are reported.
25162518 RBP2 promotes HIF-1alpha-VEGF-induced angiogenesis of non-small cell lung cancer via the Akt pathway.
23224553 With only nine point mutations, the hCRBPII mutants induced a systematic shift in the absorption profile of all-trans-retinal of more than 200 nanometers across the visible spectrum.
21382444 Data show that CRBPI and CRBPII bind 9-cis-retinol and 9-cis-retinal with high affinities, albeit with affinities somewhat lower than for all-trans-retinol and all-trans-retinal.
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19147806 HNF-4alpha is an important transcriptional factor that regulates human CRBPII gene expression; possibility for a novel function of HNF-4alpha in the regulation of human intestinal vitamin A absorption and metabolism
18076076 We report here the X-ray structures of human apo and holo CRBP II solved at 1.2 A resolution and compare the two structures between them and with the structures of zebrafish and rat CRBP II.
12016134 retinoic acid responsiveness of the human CRBP II promoter is mediated by an indirect mechanism and that this mechanism is associated with enterocyte differentiation.

AA Sequence

MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVE      1 - 70
FDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK           71 - 134
//

Text Mined References (25)

PMID Year Title
27008505 2016 RBP2 Promotes Adult Acute Lymphoblastic Leukemia by Upregulating BCL2.
26264242 2015 Retinoblastoma-binding protein 2 induces epithelial-mesenchymal transition in esophageal squamous cancer cells.
25478840 2014 Structures of holo wild-type human cellular retinol-binding protein II (hCRBPII) bound to retinol and retinal.
25162518 2014 Retinoblastoma binding protein 2 (RBP2) promotes HIF-1?-VEGF-induced angiogenesis of non-small cell lung cancer via the Akt pathway.
23224553 2012 Tuning the electronic absorption of protein-embedded all-trans-retinal.
21382444 2011 Binding affinities of CRBPI and CRBPII for 9-cis-retinoids.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
19147806 2009 Hepatocyte nuclear factor-4alpha regulates human cellular retinol-binding protein type II gene expression in intestinal cells.
18076076 2008 Crystal structure of human cellular retinol-binding protein II to 1.2 A resolution.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...