Property Summary

Ligand Count 256
NCBI Gene PubMed Count 207
PubMed Score 1972.11
PubTator Score 841.53

Knowledge Summary

Patent (3,405)

TINX Plot

  Disease (7)

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma -1.100 1.4e-03
lung cancer -2.500 1.3e-03
lung carcinoma -2.000 8.0e-06
non-small cell lung cancer -1.544 1.3e-07
osteosarcoma 1.074 8.1e-04

 HCA RNA Cell Line (3)

 CSPA Cell Line (2)

Protein-protein Interaction (1)

Gene RIF (198)

AA Sequence

MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFC      1 - 70
CQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSV     71 - 140
DRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAG    141 - 210
IALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDA    211 - 280
LAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCR    281 - 350
KSSSLREMETFVS                                                             351 - 363
//

Text Mined References (209)

PMID Year Title