Property Summary

NCBI Gene PubMed Count 198
Grant Count 442
R01 Count 239
Funding $52,131,608.2
PubMed Score 1893.80
PubTator Score 841.53

Knowledge Summary

Patent (3,405)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.074 0.001
non-small cell lung cancer -2.563 0.000
lung cancer -2.500 0.001
lung adenocarcinoma -1.100 0.001
lung carcinoma -2.000 0.000

Synonym

Accession P50052 B2R9V1 Q13016 Q6FGY7
Symbols AT2
ATGR2
MRX88

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

 GWAS Trait (1)

Gene RIF (188)

PMID Text
26867007 AT2R downregulates the expression of TGF-betaRII in human proximal tubule cells
26616438 Angiotensin II type 2 receptor is present in human semen and may be involved in the control of sperm motility and male fertility.
26225830 Ang-(1-7) downregulated AT1R mRNA, upregulated mRNA levels of Ang II type 2 receptor (AT2R) and Mas receptor (MasR) and p38-MAPK phosphorylation and suppressed H22 cell-endothelial cell communication
26163449 ATGR2 activation enhances ACE2 expression and activity and prevents TNF-alpha-stimulated ICAM-1 expression .
25816156 The A1166C polymorphism of AT1R, A1675G and C3123A polymorphisms of AT2R were analyzed. The A1675G polymorphism of AT2R might be associated with preeclampsia
25713419 Suggest a key regulatory role of ATI and ATII in promoting cellular proliferation in infantile hemangioma, and establish a role for ACE and ATIIR2 in the proliferation of this tumour.
25682288 AT1 receptor expression was associated to enhance angiogenesis and cellular proliferation rate, but no relationship with AT2 was found
25487516 Activation of intracellular angiotensin AT receptors induces rapid cell death in non-cycling uterine leiomyosarcoma cells.
25172908 Ten tagging single nucleotide polymorphisms on AGTR1/AGTR2 were genotyped for all subjects with primary aldosteronism and controls.
25138435 in colorectal cancer, AT2R expression showed an inverse correlation with tumor stage and liver metastasis
More...

AA Sequence

MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFC      1 - 70
CQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSV     71 - 140
DRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAG    141 - 210
IALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDA    211 - 280
LAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCR    281 - 350
KSSSLREMETFVS                                                             351 - 363
//

Text Mined References (200)

PMID Year Title
26867007 2016 Angiotensin II Type 2 Receptor Decreases Transforming Growth Factor-? Type II Receptor Expression and Function in Human Renal Proximal Tubule Cells.
26616438 2016 Angiotensin II type 2 receptor is expressed in human sperm cells and is involved in sperm motility.
26225830 2015 Angiotensin-(1-7) Suppresses Hepatocellular Carcinoma Growth and Angiogenesis via Complex Interactions of Angiotensin II Type 1 Receptor, Angiotensin II Type 2 Receptor and Mas Receptor.
26163449 2015 Activation of angiotensin II type 2 receptor suppresses TNF-?-induced ICAM-1 via NF-?B: possible role of ACE2.
25816156 2015 The effects of gene polymorphisms in angiotensin II receptors on pregnancy-induced hypertension and preeclampsia: a systematic review and meta-analysis.
25713419 2015 Angiotensin II causes cellular proliferation in infantile haemangioma via angiotensin II receptor 2 activation.
25682288 2015 Association between AT1 and AT2 angiotensin II receptor expression with cell proliferation and angiogenesis in operable breast cancer.
25487516 2015 Activation of intracellular angiotensin AT? receptors induces rapid cell death in human uterine leiomyosarcoma cells.
25172908 2015 Association of polymorphisms in AGTR1 and AGTR2 genes with primary aldosteronism in the Chinese Han population.
25138435 2014 Role of two types of angiotensin II receptors in colorectal carcinoma progression.
More...