Property Summary

NCBI Gene PubMed Count 21
PubMed Score 8.79
PubTator Score 8.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -2.400 2.6e-08
osteosarcoma 2.268 4.5e-03
Duchenne muscular dystrophy 1.058 1.5e-06
adrenocortical carcinoma 2.233 8.9e-07
primary pancreatic ductal adenocarcinoma -1.167 1.5e-03
diabetes mellitus 1.300 2.2e-03
posterior fossa group A ependymoma 1.100 1.9e-06
subependymal giant cell astrocytoma 1.873 4.2e-02
ovarian cancer 3.500 1.0e-05
pancreatic cancer -1.300 1.2e-03

Gene RIF (13)

PMID Text
25741866 P4HA2 was identified as a novel causative gene for nonsyndromic high myopia.
24383403 Suggest the critical role of P4HA2 in breast cancer progression and identify P4HA2 as a potential therapeutic target and biomarker for breast cancer progression.
23423382 Hypoxia-inducible factor 1 (HIF-1) promotes extracellular matrix remodeling under hypoxic conditions by inducing P4HA1, P4HA2, and PLOD2 expression in fibroblasts.
22813596 P4HA2 was upregulated in breast tumor cells compared with its adjacent normal tissues.
22190034 HIV-1 gp120 is identified to have a physical interaction with prolyl 4-hydroxylase, alpha polypeptide II (P4HA2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21859152 Overexpression of PRDX4 and P4HA2 was significantly associated with lymphatic metastasis in oral cavity squamous cell carcinoma
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
19131452 Observational study of gene-disease association. (HuGE Navigator)
17213842 Observational study of gene-disease association. (HuGE Navigator)
16917063 results show that p53 transcriptionally activates the alpha(II) collagen prolyl-4-hydroxylase [alpha(II)PH] gene, resulting in the extracellular release of antiangiogenic fragments of collagen type 4 and 18
16885164 HIF-P4H, HIF-1alpha and HIF-2alpha are effective oxygen sensors
16877351 In comparison with healthy cartilage, Osteoarthritis articular chondrocytes exhibit increased in vivo synthesis of collagen prolyl-4-hydroxylase type II, a pivotal enzyme in collagen triple helix formation.
12824157 the substrate specificity, binding site and conformation of this enzyme

AA Sequence

MKLWVSALLMAWFGVLSCVQAEFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEALTS      1 - 70
KSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQ     71 - 140
DTYRLDPGTISRGELPGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVL    141 - 210
DYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERP    211 - 280
VDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEI    281 - 350
ERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVAN    351 - 420
YGVGGQYEPHFDFSRNDERDTFKHLGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLL    421 - 490
RSGEGDYRTRHAACPVLVGCKWVSNKWFHERGQEFLRPCGSTEVD                             491 - 535
//

Text Mined References (23)

PMID Year Title
25741866 2015 Mutations of P4HA2 encoding prolyl 4-hydroxylase 2 are associated with nonsyndromic high myopia.
25416956 2014 A proteome-scale map of the human interactome network.
24383403 2014 Prolyl-4-hydroxylase ? subunit 2 promotes breast cancer progression and metastasis by regulating collagen deposition.
23423382 2013 Hypoxia-inducible factor 1 (HIF-1) promotes extracellular matrix remodeling under hypoxic conditions by inducing P4HA1, P4HA2, and PLOD2 expression in fibroblasts.
22813596 2012 Profiling and comparative analysis of glycoproteins in Hs578BST and Hs578T and investigation of prolyl 4-hydroxylase alpha polypeptide II expression and influence in breast cancer cells.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21859152 2011 Identification of PRDX4 and P4HA2 as metastasis-associated proteins in oral cavity squamous cell carcinoma by comparative tissue proteomics of microdissected specimens using iTRAQ technology.
21269460 2011 Initial characterization of the human central proteome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
19131452 2009 Genetic association study for RSV bronchiolitis in infancy at the 5q31 cytokine cluster.
17213842 2007 Refined genomic localization and ethnic differences observed for the IBD5 association with Crohn's disease.
16917063 2006 p53-mediated inhibition of angiogenesis through up-regulation of a collagen prolyl hydroxylase.
16885164 2006 The length of peptide substrates has a marked effect on hydroxylation by the hypoxia-inducible factor prolyl 4-hydroxylases.
16877351 2006 Regulation of type II collagen synthesis during osteoarthritis by prolyl-4-hydroxylases: possible influence of low oxygen levels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14500733 2003 Identification and characterization of a third human, rat, and mouse collagen prolyl 4-hydroxylase isoenzyme.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12824157 2003 The peptide-substrate-binding domain of human collagen prolyl 4-hydroxylases. Backbone assignments, secondary structure, and binding of proline-rich peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11606192 2001 Characterization of the human and mouse genes for the alpha subunit of type II prolyl 4-hydroxylase. Identification of a previously unknown alternatively spliced exon and its expression in various tissues.
9211872 1997 Cloning of the human prolyl 4-hydroxylase alpha subunit isoform alpha(II) and characterization of the type II enzyme tetramer. The alpha(I) and alpha(II) subunits do not form a mixed alpha(I)alpha(II)beta2 tetramer.