Property Summary

NCBI Gene PubMed Count 97
Grant Count 234
R01 Count 133
Funding $28,557,830.52
PubMed Score 482.38
PubTator Score 299.24

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P49961 A9Z1X8 B4DWB9 B4E1X1 B7Z599 G3XAF6 Q5T561 Q5T562 Q86VV3 Q9UQQ9 Q9Y3Q9 NTPDase 1
Symbols CD39
SPG64
ATPDase
NTPDase-1

Gene

Gene RIF (79)

PMID Text
26832412 Increased inducibility of CD39 after activation may contribute to the impaired vaccine response with age.
26549640 Findings provide insights into Tc1-mediated IFNgamma responses and ROS generation and link these pathways to CD39/adenosine-mediated effects in immunological disease.
26386144 the expression of CD39 on Treg cells and also in CD4(+)IL-17(+) cells from T2D patients is related to hyperglycemia as well as to overweight and obesity and therefore may participate as a modulator of the effector capacity of Th17 cells.
26307000 The altered function and expression of P2X7 and ART1 in the human CD39+ Treg or CD39- Treg cells could participate in the resistance against cell death induced by ATP or NAD.
26226423 role of CD73 and CD39 ectonucleotidases in T cell differentiation
26121751 these data establish CD39 as a regionalized regulator of atherogenesis that is driven by shear stress.
26113408 the current study revealed that malignant epithelial cells of human rectal adenocarcinoma strongly express CD39 that may play a potential role in the tumor invasion and metastasis.
26059452 We suggest modulation of human Th17 responsiveness by CD39 and CD161 and describe novel molecular mechanisms integrating elements of both extracellular nucleotide and sphingolipid homeostasis--{REVIEW}
26018728 Despite the increased level of NTPDase1 and NTPDase3 mRNA expression in chondrogenically induced MSCs, their activity toward ATP remains quite low.
25877509 The Na-K-2Cl cotransporter was downregulated by high-sodium diet in wild-type mice, but it increased in transgenic mice overexpressing human CD39
More...

AA Sequence

MEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLYIYKWPAE      1 - 70
KENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRME     71 - 140
SEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPYETNNQETFG    141 - 210
ALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRD    211 - 280
PCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFL    281 - 350
PPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYIL    351 - 420
SLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFLMVLFSLVLFT    421 - 490
VAIIGLLIFHKPSYFWKDMV                                                      491 - 510
//

Text Mined References (100)

PMID Year Title
26832412 2016 Expression of CD39 on Activated T Cells Impairs their Survival in Older Individuals.
26549640 2015 NADH oxidase-dependent CD39 expression by CD8(+) T cells modulates interferon gamma responses via generation of adenosine.
26386144 2015 CD39 expression on Treg and Th17 cells is associated with metabolic factors in patients with type 2 diabetes.
26307000 2016 Evaluation of the expression and function of the P2X7 receptor and ART1 in human regulatory T-cell subsets.
26226423 2015 CD73 and CD39 ectonucleotidases in T cell differentiation: Beyond immunosuppression.
26121751 2015 Flow-dependent expression of ectonucleotide tri(di)phosphohydrolase-1 and suppression of atherosclerosis.
26113408 2015 High expression of CD39/ENTPD1 in malignant epithelial cells of human rectal adenocarcinoma.
26059452 2015 Beyond ecto-nucleotidase: CD39 defines human Th17 cells with CD161.
26018728 2015 Chondrogenic Differentiation of Human Mesenchymal Stem Cells Results in Substantial Changes of Ecto-Nucleotides Metabolism.
25877509 2015 Impaired natriuretic response to high-NaCl diet plus aldosterone infusion in mice overexpressing human CD39, an ectonucleotidase (NTPDase1).
More...