Property Summary

NCBI Gene PubMed Count 195
Grant Count 69
R01 Count 60
Funding $10,525,122.81
PubMed Score 90.00
PubTator Score 340.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.197 0.002
posterior fossa group B ependymoma 1.800 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.300 0.001
lung cancer 1.500 0.000
colon cancer 1.200 0.007
group 3 medulloblastoma 1.600 0.000

Synonym

Accession P49959 B3KTC7 O43475
Symbols ATLD
HNGS1
MRE11A
MRE11B

Gene

PDB

3T1I  

Gene RIF (147)

PMID Text
26676960 The expression of DSB repair proteins such as RAD51 and MRE11 was investigated by immunohistochemistry, and associations between RAD51 and MRE11 expression and clinicopathological factors or chemotherapeutic effect were assessed
26627254 Rad51 recombinase prevents Mre11 nuclease-dependent degradation and excessive PrimPol-mediated elongation of nascent DNA after UV irradiation
26514363 This study found a significant trend indicating that the risk increases as the number of adverse alleles increase and significant three-locus interaction model involving NBS1 rs1805794, MRE11 rs10831234, and ATM rs227062.
26366868 a significant increase in DKC1, RAD50, MRE11 and RPA1 expression in MM cases with high bone marrow infiltration (p</=0.03) and a tendency towards cases with advanced ISS stage
26068589 The MRN complex is essential to restrain MYCN-induced replication stress during neural cell proliferation.
25903339 This work demonstrates that the Mre11-Rad50-Nbs1 DNA repair complex positively regulates AAV replication and plays a role in the integration of adeno-associated airus in the presence of herpes simplex virus 1.
25788520 The importance of the FGFR2-Mre11-DSBR link in cancer progression is suggested by the finding that genotypes of FGFR2 and Mre11 are associated with survival of breast cancer patients
25576492 Furthermore, they collectively help to explain how MRN regulates DNA repair pathway choice. [review]
25320294 These results articulate a model of inhibition of adeno-associated virus gene expression in which physical interaction of viral DNA with Mre11/Rad50/Nbs1 complex is more important than enzymatic activity.
25310185 Analysis of this small number of colon cancer patients showed the dMRE11 marker predicts better prognosis independent of treatment in the long-term. In subgroup analyses, dMRE11 patients treated with irinotecan exhibited unexplained short-term mortality
More...

AA Sequence

MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRK      1 - 70
TLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCA     71 - 140
LDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSW    141 - 210
FNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAV    211 - 280
KKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERE    281 - 350
RLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITK    351 - 420
PSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHI    421 - 490
DALEDKIDEEVRRFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAFSADDLMSIDLAEQMANDSDD    491 - 560
SISAATNKGRGRGRGRRGGRGQNSASRGGSQRGRADTGLETSTRSRNSKTAVSASRNMSIIDAFKSTRQQ    561 - 630
PSRNVTTKNYSEVIEVDESDVEEDIFPTTSKTDQRWSSTSSSKIMSQSQVSKGVDFESSEDDDDDPFMNT    631 - 700
SSLRRNRR                                                                  701 - 708
//

Text Mined References (211)

PMID Year Title
27568553 2016 MRNIP/C5orf45 Interacts with the MRN Complex and Contributes to the DNA Damage Response.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26807646 2016 EXD2 promotes homologous recombination by facilitating DNA end resection.
26676960 2016 Expression of DNA double-strand break repair proteins predicts the response and prognosis of colorectal cancer patients undergoing oxaliplatin-based chemotherapy.
26627254 2015 Rad51 recombinase prevents Mre11 nuclease-dependent degradation and excessive PrimPol-mediated elongation of nascent DNA after UV irradiation.
26525166 2015 Relative contribution of four nucleases, CtIP, Dna2, Exo1 and Mre11, to the initial step of DNA double-strand break repair by homologous recombination in both the chicken DT40 and human TK6 cell lines.
26514363 2016 Genetic variations in the homologous recombination repair pathway genes modify risk of glioma.
26366868 2015 Differential Expression of Non-Shelterin Genes Associated with High Telomerase Levels and Telomere Shortening in Plasma Cell Disorders.
26068589 2016 The MRN complex is transcriptionally regulated by MYCN during neural cell proliferation to control replication stress.
25903339 2015 Impact of the MRN Complex on Adeno-Associated Virus Integration and Replication during Coinfection with Herpes Simplex Virus 1.
More...