Property Summary

NCBI Gene PubMed Count 159
Grant Count 146
R01 Count 80
Funding $20,716,494.4
PubMed Score 600.46
PubTator Score 470.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P49918
Symbols BWS
WBS
p57
BWCR
KIP2
p57Kip2

Gene

 GO Component (2)

Gene RIF (138)

PMID Text
26606000 Jab1/Csn5 expression with concurrent low p57 expression associated with poor overall survival in hepatocellular carcinoma
26362858 These results indicate that the inhibitory effect of rapamycin may be due mainly to increased p14, p15, and p57 expression via promoter demethylation and decreased mTOR and p70S6K expression in ALL cell lines.
26271467 Our data indicated that reduced cytoplasmic p57 expression is associated with hepatocellular carcinoma invasion.
26161420 Polymer-based immunohistochemical staining of p57(kip2) (paternally imprinted gene, expressed from maternal allele) is a very effective method that can be used to differentiate androgenetic complete mole from partial mole and hydropic abortion.
26091021 Using human placental samples, we show that the expression of the imprinted gene CDKN1C associates with birth weight
26077438 CDKN1C sequencing should be performed for BWS patients presenting with abdominal wall defects or cleft palate without 11p15 methylation defects or body asymmetry, or in familial cases of BWS.
25960208 downregulation of CDKN1 by siRNA blocked the activity of miR-25 on promoting glioma cell proliferation.
25588980 Up-regulation of miR-199a-5p in ADPKD tissues might promote cell proliferation through suppressing CDKN1C
25427884 Data show the presence of maternally derived extra copies of the distal chromosome 11p involving the wild-type cyclin-dependent kinase inhibitor 1C protein (CDKN1C).
25339094 Lefty1 could regulates the cell cycle via modulating the expressions of P57 and cyclin D1 and then inhibit the decidualization in vitro.
More...

AA Sequence

MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMP      1 - 70
LRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVP     71 - 140
VPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAP    141 - 210
APAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRK    211 - 280
RSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR                                      281 - 316
//

Text Mined References (157)

PMID Year Title
26606000 2016 Down-regulation of the cyclin-dependent kinase inhibitor p57 is mediated by Jab1/Csn5 in hepatocarcinogenesis.
26362858 2015 Rapamycin restores p14, p15 and p57 expression and inhibits the mTOR/p70S6K pathway in acute lymphoblastic leukemia cells.
26271467 2015 The role of cytoplasmic p57 in invasion of hepatocellular carcinoma.
26161420 2015 Clinical Usefulness of Immunohistochemical Staining of p57 kip2 for the Differential Diagnosis of Complete Mole.
26091021 2015 Placental 5-methylcytosine and 5-hydroxymethylcytosine patterns associate with size at birth.
26077438 2015 Mutations of the Imprinted CDKN1C Gene as a Cause of the Overgrowth Beckwith-Wiedemann Syndrome: Clinical Spectrum and Functional Characterization.
25960208 2015 miR-25 promotes glioma cell proliferation by targeting CDKN1C.
25588980 2015 Inhibition of MiR-199a-5p reduced cell proliferation in autosomal dominant polycystic kidney disease through targeting CDKN1C.
25427884 2015 Silver-Russell syndrome without body asymmetry in three patients with duplications of maternally derived chromosome 11p15 involving CDKN1C.
25339094 2014 Lefty inhibits in vitro decidualization by regulating P57 and cyclin D1 expressions.
More...