Property Summary

NCBI Gene PubMed Count 139
Grant Count 90
R01 Count 57
Funding $6,081,443.67
PubMed Score 136.00
PubTator Score 246.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P49917 Q8IY66 Q8TEU5
Symbols LIG4S

Gene

PDB

1IK9   3II6   3W1B   3W1G   4HTP   2E2W   3VNN   3W5O   4HTO  

Gene RIF (108)

PMID Text
27009971 LIG4 is highly upregulated in human colorectal cancer cells.
26762768 Five novel mutations in LIG4 and a potential hotspot mutation (c.833G > T; p.R278L) in the Chinese population with LIG4 deficiency syndrome were identified.
26201248 Our data showed that Cd altered the phosphorylation of DNA-PKcs, and reduced the expression of both XRCC4 and Ligase IV in irradiated cells.
26134445 Our study identifies LIG4 as a predictor of an increased risk for early biochemical recurrence in prostate cancer
25973104 our results suggest that LIG4 rs10131 polymorphism in the DNA repair pathways plays an important role in the risk of glioma in a Chinese population.
25811031 The genetic polymorphisms in LIG4 rs1805388 and HSPB1 rs2868371 were not obviously correlated with the risk of radiation pneumonitis and radiation-induced lung injury of lung cancer.
25605214 High LIG4 expression is associated with less radiosensitivity of nasopharyngeal cancer.
25314918 despite several limitations, this meta-analysis suggested that LIG4 T9I genetic variant is associated with a decreased risk of cancer among Caucasians, however, the rs1805386 gene polymorphism is not a risk factor of cancer.
25201414 Results show that in cells deficient for Lig4, chromosomal translocations junctions had significantly longer deletions and more microhomologies.
24984242 DNA Ligase IV is required for efficient localization of XRCC4 and XLF into cell nucleus.
More...

AA Sequence

MAASQTSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHKDVTDSFYPAMRL      1 - 70
ILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTPTGTHGDAGDFAMIAYFVLKPRCLQK     71 - 140
GSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHND    141 - 210
AAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQ    211 - 280
MHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFD    281 - 350
IKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNE    351 - 420
AIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMMSHFLCAVAEK    421 - 490
PPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIK    491 - 560
AAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRGKASGKLASKHLYIGGDDEPQEKKRKA    561 - 630
APKMKKVIGIIEHLKAPNLTNVNKISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCV    631 - 700
IAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTD    701 - 770
LNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAI    771 - 840
KALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYL    841 - 910
I//

Text Mined References (144)

PMID Year Title
27009971 2016 LIG4 mediates Wnt signalling-induced radioresistance.
26762768 2016 Molecular and immunological characterization of DNA ligase IV deficiency.
26201248 2015 Cadmium delays non-homologous end joining (NHEJ) repair via inhibition of DNA-PKcs phosphorylation and downregulation of XRCC4 and Ligase IV.
26134445 2015 Expression of DNA ligase IV is linked to poor prognosis and characterizes a subset of prostate cancers harboring TMPRSS2:ERG fusion and PTEN deletion.
25973104 2015 Association of LIG4 and XRCC4 gene polymorphisms with the risk of human glioma in a Chinese population.
25941166 2015 XLS (c9orf142) is a new component of mammalian DNA double-stranded break repair.
25811031 2015 Associations of LIG4 and HSPB1 genetic polymorphisms with risk of radiation-induced lung injury in lung cancer patients treated with radiotherapy.
25728776 2015 Mutations in the NHEJ component XRCC4 cause primordial dwarfism.
25670504 2015 Interactome analysis identifies a new paralogue of XRCC4 in non-homologous end joining DNA repair pathway.
25605214 2014 DNA ligase4 as a prognostic marker in nasopharyngeal cancer patients treated with radiotherapy.
More...