Property Summary

NCBI Gene PubMed Count 80
PubMed Score 531.14
PubTator Score 74.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.0e-05
Breast cancer 2.100 3.4e-02
group 3 medulloblastoma 1.900 1.4e-06
lung cancer 1.100 1.8e-02
malignant mesothelioma 1.100 1.9e-05
medulloblastoma, large-cell 1.400 1.1e-05
non-small cell lung cancer 1.117 6.6e-18
osteosarcoma -2.970 2.4e-09
primitive neuroectodermal tumor 1.100 1.5e-03
psoriasis 1.200 6.5e-03
Rheumatoid arthritis -1.100 2.2e-02
spina bifida -1.027 4.5e-02
subependymal giant cell astrocytoma -1.005 3.6e-02

Protein-protein Interaction (8)

Gene RIF (56)

AA Sequence

MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQGSHLRSRATY      1 - 70
LVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHI     71 - 140
KCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQHIADLSSKAAGTPKKKAVVQAKLTTTGQVTS    141 - 210
PVKGASFVTSTNPRKFSGFSAKPNNSGEAPSSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYN    211 - 280
TKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDV    281 - 350
SETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL    351 - 420
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTPVQPMLAEACK    421 - 490
SVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDSE    491 - 560
VLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIPNRIMF    561 - 630
SEMKRVTKALDLADMITRVIQEGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYG    631 - 700
QGSKGGMMSIFLMGCYDPGSQKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPD    701 - 770
FIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV    771 - 840
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLAT    841 - 910
KSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLG    911 - 980
SRDKNPAAQQVSPEWIWACIRKRRLVAPC                                             981 - 1009
//

Text Mined References (93)

PMID Year Title