| Tbio | DNA ligase 3 |
Isoform 3 functions as heterodimer with DNA-repair protein XRCC1 in the nucleus and can correct defective DNA strand-break repair and sister chromatid exchange following treatment with ionizing radiation and alkylating agents. Isoform 1 is targeted to mitochondria, where it functions as DNA ligase in mitochondrial base-excision DNA repair (PubMed:10207110, PubMed:24674627).
This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| non-small cell lung cancer | 2798 | 6.63511474244049E-18 |
| osteosarcoma | 7933 | 1.02120426182547E-10 |
| atypical teratoid / rhabdoid tumor | 4369 | 6.81754609097181E-7 |
| medulloblastoma, large-cell | 6234 | 1.02082578892253E-6 |
| group 3 medulloblastoma | 2254 | 1.4298623408761E-6 |
| malignant mesothelioma | 3163 | 1.91248212271017E-5 |
| primitive neuroectodermal tumor | 3031 | 0.00150887795100947 |
| psoriasis | 6685 | 0.00653595778206912 |
| lung cancer | 4473 | 0.0179133458506933 |
| Rheumatoid Arthritis | 1171 | 0.0220775159288334 |
| Breast cancer | 3099 | 0.0337300080070779 |
| subependymal giant cell astrocytoma | 2287 | 0.0360068964488585 |
| spina bifida | 1064 | 0.0450154860830425 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Heart conduction disease | 65 | 0.0 | 2.0 |
| Disease | log2 FC | p |
|---|---|---|
| Rheumatoid Arthritis | -1.100 | 0.022 |
| malignant mesothelioma | 1.100 | 0.000 |
| psoriasis | 1.200 | 0.007 |
| osteosarcoma | -3.916 | 0.000 |
| group 3 medulloblastoma | 1.900 | 0.000 |
| atypical teratoid / rhabdoid tumor | 1.600 | 0.000 |
| medulloblastoma, large-cell | 2.000 | 0.000 |
| primitive neuroectodermal tumor | 1.100 | 0.002 |
| non-small cell lung cancer | 1.117 | 0.000 |
| lung cancer | 1.100 | 0.018 |
| Breast cancer | 2.100 | 0.034 |
| subependymal giant cell astrocytoma | -1.005 | 0.036 |
| spina bifida | -1.027 | 0.045 |
| Species | Source |
|---|---|
| Chimp | OMA EggNOG |
| Macaque | OMA EggNOG Inparanoid |
| Mouse | OMA EggNOG Inparanoid |
| Rat | OMA EggNOG Inparanoid |
| Dog | OMA EggNOG Inparanoid |
| Horse | OMA EggNOG Inparanoid |
| Cow | OMA EggNOG Inparanoid |
| Opossum | OMA EggNOG Inparanoid |
| Chicken | OMA EggNOG Inparanoid |
| Xenopus | OMA EggNOG Inparanoid |
| Fruitfly | EggNOG Inparanoid |
| PMID | Text |
|---|---|
| 26449312 | A computational approach to determine susceptibility to cancer by evaluating the deleterious effect of nsSNP in XRCC1 gene on binding interaction of XRCC1 protein with ligase III. |
| 26130724 | Domains constituting the LigIII catalytic core collaborate and are essential for formation of a DNA-bridging intermediate by adenylated LigIII that positions a pair of blunt-ended duplex DNAs for efficient and specific intermolecular ligation. |
| 25828893 | In the context of tyrosine kinase-activated leukemias, c-MYC contributes to aberrant DNA repair through downstream targets LIG3 and PARP1 up-regulation. |
| 25817347 | The g.29661G>A and g.29059C>T polymorphisms of LIG3 may play a role in the keratoconus and Fuchs endothelial corneal dystrophy pathogenesis and can be considered as markers in these diseases. |
| 25127141 | there is an absolute requirement for fully functional DNA ligase III (LIG3), but not ligase IV (LIG4), to facilitate the escape from a telomere-driven crisis. |
| 24837021 | LIGIII plays a role in additional EJing repair pathway only in the absence of Ku. |
| 24674627 | Results show that overexpression of DNA ligase III in mitochondria improves mitochondrial base excision repair and enhances cell survival after oxidative stress. |
| 24342190 | data confirm previous work showing that Lig3 is required to maintain mtDNA integrity and function, and highlight a new function of ATM in regulating DNA Lig3 stability and consequently mtDNA repair |
| 22632162 | HIV-1 Rev interacting protein, ligase III, DNA, ATP-dependent (LIG3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with LIG3 is increased by RRE |
| 22174317 | HIV-1 Rev interacting protein, ligase III, DNA, ATP-dependent (LIG3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with LIG3 is increased by RRE |
| More... |
MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQGSHLRSRATY 1 - 70 LVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHI 71 - 140 KCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQHIADLSSKAAGTPKKKAVVQAKLTTTGQVTS 141 - 210 PVKGASFVTSTNPRKFSGFSAKPNNSGEAPSSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYN 211 - 280 TKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDV 281 - 350 SETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL 351 - 420 KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTPVQPMLAEACK 421 - 490 SVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDSE 491 - 560 VLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIPNRIMF 561 - 630 SEMKRVTKALDLADMITRVIQEGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYG 631 - 700 QGSKGGMMSIFLMGCYDPGSQKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPD 701 - 770 FIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV 771 - 840 VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLAT 841 - 910 KSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLG 911 - 980 SRDKNPAAQQVSPEWIWACIRKRRLVAPC 981 - 1009 //
| PMID | Year | Title |
|---|---|---|
| 26496610 | 2015 | A human interactome in three quantitative dimensions organized by stoichiometries and abundances. |
| 26449312 | 2016 | A computational approach to determine susceptibility to cancer by evaluating the deleterious effect of nsSNP in XRCC1 gene on binding interaction of XRCC1 protein with ligase III. |
| 26130724 | 2015 | Human DNA ligase III bridges two DNA ends to promote specific intermolecular DNA end joining. |
| 25828893 | 2015 | c-MYC Generates Repair Errors via Increased Transcription of Alternative-NHEJ Factors, LIG3 and PARP1, in Tyrosine Kinase-Activated Leukemias. |
| 25817347 | 2015 | Polymorphism of the LIG3 gene in keratoconus and Fuchs endothelial corneal dystrophy. |
| 25609649 | 2015 | Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes. |
| 25127141 | 2014 | Escape from telomere-driven crisis is DNA ligase III dependent. |
| 24952745 | 2014 | Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization. |
| 24837021 | 2014 | DNA ligase III and DNA ligase IV carry out genetically distinct forms of end joining in human somatic cells. |
| 24674627 | 2014 | Overexpression of DNA ligase III in mitochondria protects cells against oxidative stress and improves mitochondrial DNA base excision repair. |
| More... |
