Property Summary

NCBI Gene PubMed Count 79
Grant Count 132
R01 Count 92
Funding $16,125,887.22
PubMed Score 505.05
PubTator Score 74.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.022
malignant mesothelioma 1.100 0.000
psoriasis 1.200 0.007
osteosarcoma -3.916 0.000
group 3 medulloblastoma 1.900 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.100 0.002
non-small cell lung cancer 1.117 0.000
lung cancer 1.100 0.018
Breast cancer 2.100 0.034
subependymal giant cell astrocytoma -1.005 0.036
spina bifida -1.027 0.045

Synonym

Accession P49916 E5KLB5 E5KLB6 Q16714 Q6NVK3
Symbols LIG2

Gene

PDB

1IMO   1IN1   1UW0   3L2P   3PC7   3PC8   3QVG  

 GWAS Trait (1)

Gene RIF (55)

PMID Text
26449312 A computational approach to determine susceptibility to cancer by evaluating the deleterious effect of nsSNP in XRCC1 gene on binding interaction of XRCC1 protein with ligase III.
26130724 Domains constituting the LigIII catalytic core collaborate and are essential for formation of a DNA-bridging intermediate by adenylated LigIII that positions a pair of blunt-ended duplex DNAs for efficient and specific intermolecular ligation.
25828893 In the context of tyrosine kinase-activated leukemias, c-MYC contributes to aberrant DNA repair through downstream targets LIG3 and PARP1 up-regulation.
25817347 The g.29661G>A and g.29059C>T polymorphisms of LIG3 may play a role in the keratoconus and Fuchs endothelial corneal dystrophy pathogenesis and can be considered as markers in these diseases.
25127141 there is an absolute requirement for fully functional DNA ligase III (LIG3), but not ligase IV (LIG4), to facilitate the escape from a telomere-driven crisis.
24837021 LIGIII plays a role in additional EJing repair pathway only in the absence of Ku.
24674627 Results show that overexpression of DNA ligase III in mitochondria improves mitochondrial base excision repair and enhances cell survival after oxidative stress.
24342190 data confirm previous work showing that Lig3 is required to maintain mtDNA integrity and function, and highlight a new function of ATM in regulating DNA Lig3 stability and consequently mtDNA repair
22632162 HIV-1 Rev interacting protein, ligase III, DNA, ATP-dependent (LIG3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with LIG3 is increased by RRE
22174317 HIV-1 Rev interacting protein, ligase III, DNA, ATP-dependent (LIG3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with LIG3 is increased by RRE
More...

AA Sequence

MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQGSHLRSRATY      1 - 70
LVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHI     71 - 140
KCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQHIADLSSKAAGTPKKKAVVQAKLTTTGQVTS    141 - 210
PVKGASFVTSTNPRKFSGFSAKPNNSGEAPSSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYN    211 - 280
TKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDV    281 - 350
SETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL    351 - 420
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTPVQPMLAEACK    421 - 490
SVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDSE    491 - 560
VLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIPNRIMF    561 - 630
SEMKRVTKALDLADMITRVIQEGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYG    631 - 700
QGSKGGMMSIFLMGCYDPGSQKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPD    701 - 770
FIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV    771 - 840
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLAT    841 - 910
KSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLG    911 - 980
SRDKNPAAQQVSPEWIWACIRKRRLVAPC                                             981 - 1009
//

Text Mined References (92)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26449312 2016 A computational approach to determine susceptibility to cancer by evaluating the deleterious effect of nsSNP in XRCC1 gene on binding interaction of XRCC1 protein with ligase III.
26130724 2015 Human DNA ligase III bridges two DNA ends to promote specific intermolecular DNA end joining.
25828893 2015 c-MYC Generates Repair Errors via Increased Transcription of Alternative-NHEJ Factors, LIG3 and PARP1, in Tyrosine Kinase-Activated Leukemias.
25817347 2015 Polymorphism of the LIG3 gene in keratoconus and Fuchs endothelial corneal dystrophy.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25127141 2014 Escape from telomere-driven crisis is DNA ligase III dependent.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24837021 2014 DNA ligase III and DNA ligase IV carry out genetically distinct forms of end joining in human somatic cells.
24674627 2014 Overexpression of DNA ligase III in mitochondria protects cells against oxidative stress and improves mitochondrial DNA base excision repair.
More...