Property Summary

NCBI Gene PubMed Count 23
Grant Count 5
R01 Count 5
Funding $1,761,805
PubMed Score 12.84
PubTator Score 17.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 0.034

Synonym

Accession P49914 H3BQ75
Symbols HsT19268

Gene

PANTHER Protein Class (1)

PDB

3HXT   3HY3   3HY4   3HY6  

Gene RIF (12)

PMID Text
21895484 The intronic Single nucleotide polymorphism in MTHFS had no significant effect on the risk of diabetic nephropathy in Taiwanese patients with T2D.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20570913 Observational study of gene-disease association. (HuGE Navigator)
19936946 Observational study of gene-disease association. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18522750 Observational study of gene-disease association. (HuGE Navigator)
17891500 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKD      1 - 70
IFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFD     71 - 140
KHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA           141 - 203
//

Text Mined References (26)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21895484 2012 The impact of 5,10-methenyltetrahydrofolate synthetase polymorphism on diabetic nephropathy in the Taiwanese population.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20570913 2010 Genetic variation in TYMS in the one-carbon transfer pathway is associated with ovarian carcinoma types in the Ovarian Cancer Association Consortium.
19936946 2010 Germline polymorphisms in the one-carbon metabolism pathway and DNA methylation in colorectal cancer.
19738041 2009 Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...