Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.82
PubTator Score 17.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cleft Lip 141 0.0 0.0
Cleft Palate 271 0.0 0.0
Disease Target Count P-value
non primary Sjogren syndrome sicca 891 3.4e-02
Disease Target Count Z-score Confidence
Tularemia 23 3.371 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 3.4e-02

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKD      1 - 70
IFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFD     71 - 140
KHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA           141 - 203
//

Text Mined References (26)

PMID Year Title