Property Summary

NCBI Gene PubMed Count 258
PubMed Score 1961.90
PubTator Score 1544.58

Knowledge Summary


No data available


  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.439 0.022
osteosarcoma -6.012 0.000
COPD -1.100 0.046
lung adenocarcinoma -2.100 0.000
Breast cancer 1.600 0.040
psoriasis 2.600 0.000


Accession P49913 Q71SN9
Symbols LL37



2FBS   2FBU   2FCG   2K6O   2LMF   4EYC  

  Ortholog (6)

Species Source
Chimp OMA Inparanoid
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid

Gene RIF (224)

26903652 Data indicate that endoplasmic reticulum (ER) stress increase sphingosine-1-phosphate (S1P) production, in turn activating nuclear factor kappa B (NF-kappaB)-mediated cathelicidin antimicrobial peptide (CAMP) synthesis.
26873992 higher nasal levels are associated with protection against RSV infection, directly damages viral envelopes and disrupts viral particles
26778002 Taken together, these observations suggest that activation of human mast cells by LL-37 could be modified by TLR2 ligands and the function of human mast cells could be switched from allergic reactions to innate immune response.
26585423 In rhinovirus infected cystic fibrosis patients, LL37 was inversely correlated with viral load in bronchoalveolar lavage fluid.
26556394 The human cathelicidin LL-37--A pore-forming antibacterial peptide and host-cell modulator.
26502164 LL-37 interacts with negatively charged membranes forming a stable aggregate, which may produce toroidal pores. There is also an aggregate with a higher oligomeric degree for interaction of LL-37 with neutral membranes.
26468750 The authors show that the group A Streptococcus surface-associated M1 protein sequesters and neutralizes LL-37 antimicrobial activity through its N-terminal domain.
26433491 we discuss 1,25D3-induced down-regulation of cytokine/chemokine production and stimulation of hCAP-18/LL-37 gene expression which represent two very important pathways for 1,25D3-evoked regulation of the innate immune response--{REVIEW}
26422567 Cathelicidin appears to play different roles in the development of pulmonary sarcoidosis and tuberculosis.
26416907 Chlamydial plasmid-encoded virulence factor Pgp3 neutralizes the antichlamydial activity of human cathelicidin LL-37.

AA Sequence

KSKEKIGKEFKRIVQRIKDFLRNLVPRTES                                            141 - 170

Text Mined References (259)

PMID Year Title
26903652 2016 ER stress stimulates production of the key antimicrobial peptide, cathelicidin, by forming a previously unidentified intracellular S1P signaling complex.
26873992 2016 Cathelicidins Have Direct Antiviral Activity against Respiratory Syncytial Virus In Vitro and Protective Function In Vivo in Mice and Humans.
26778002 2016 The modulatory effect of TLR2 on LL-37-induced human mast cells activation.
26585423 2016 Vitamin D represses rhinovirus replication in cystic fibrosis cells by inducing LL-37.
26556394 2016 The human cathelicidin LL-37--A pore-forming antibacterial peptide and host-cell modulator.
26502164 2015 A Spectroscopic Study of the Aggregation State of the Human Antimicrobial Peptide LL-37 in Bacterial versus Host Cell Model Membranes.
26468750 2015 Group A Streptococcal M1 Protein Sequesters Cathelicidin to Evade Innate Immune Killing.
26433491 2016 Vitamin D3 modulates the innate immune response through regulation of the hCAP-18/LL-37 gene expression and cytokine production.
26422567 2015 Cathelicidin as a link between sarcoidosis and tuberculosis.
26416907 2015 Chlamydial plasmid-encoded virulence factor Pgp3 neutralizes the antichlamydial activity of human cathelicidin LL-37.