Property Summary

NCBI Gene PubMed Count 280
PubMed Score 2089.32
PubTator Score 1544.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 2.600 3.9e-52
Breast cancer 1.600 4.0e-02
COPD -1.100 4.6e-02
lung adenocarcinoma -2.100 2.9e-11
osteosarcoma -6.012 1.1e-09
Waldenstrons macroglobulinemia 1.439 2.2e-02

Synonym

Accession P49913 Q71SN9
Symbols LL37
CAP18
CRAMP
HSD26
CAP-18
FALL39
FALL-39

Gene

PDB

2FBS   2FBU   2FCG   2K6O   2LMF   2NA3   4EYC  

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (245)

AA Sequence

MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGD      1 - 70
PDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFR     71 - 140
KSKEKIGKEFKRIVQRIKDFLRNLVPRTES                                            141 - 170
//

Text Mined References (281)

PMID Year Title