Property Summary

NCBI Gene PubMed Count 93
PubMed Score 339.46
PubTator Score 106.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cancer 2499 3.318 1.7

Expression

  Differential Expression (26)

Disease log2 FC p
active ulcerative colitis 2.769 2.1e-02
Atopic dermatitis -1.200 2.4e-03
atypical teratoid / rhabdoid tumor -1.500 3.1e-02
Breast cancer -1.400 4.3e-06
chronic rhinosinusitis -1.029 3.8e-02
colon cancer -1.700 8.0e-03
cystic fibrosis -1.900 8.1e-03
Down syndrome 1.400 5.1e-03
Duchenne muscular dystrophy 1.171 9.1e-08
ependymoma -1.100 9.1e-03
gastric carcinoma -1.200 4.2e-02
group 3 medulloblastoma -2.200 2.1e-03
intraductal papillary-mucinous adenoma (... -1.600 4.0e-04
intraductal papillary-mucinous neoplasm ... -2.800 1.8e-03
invasive ductal carcinoma -1.300 8.8e-03
lung adenocarcinoma -1.100 1.1e-06
lung cancer -1.700 1.3e-04
lung carcinoma -1.500 1.2e-10
medulloblastoma, large-cell -1.700 7.7e-03
Multiple myeloma 2.877 4.3e-04
non diabetic and post-ischemic heart fai... 1.100 4.7e-03
non-small cell lung cancer -1.237 1.4e-20
osteosarcoma 1.332 1.7e-03
ovarian cancer -2.400 1.4e-04
pancreatic ductal adenocarcinoma liver m... -1.575 1.1e-03
pituitary cancer -1.700 3.1e-05

 GO Function (1)

Gene RIF (74)

AA Sequence

MWRSLGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASUYLCILQASKLE      1 - 70
DLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRC     71 - 140
GRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHH    141 - 210
HNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKR    211 - 280
CINQLLCKLPTDSELAPRSUCCHCRHLIFEKTGSAITUQCKENLPSLCSUQGLRAEENITESCQURLPPA    281 - 350
AUQISQQLIPTEASASURUKNQAKKUEUPSN                                           351 - 381
//

Text Mined References (97)

PMID Year Title