Property Summary

NCBI Gene PubMed Count 82
Grant Count 78
R01 Count 50
Funding $9,069,474.09
PubMed Score 315.17
PubTator Score 106.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P49908 Q6PD59 Q6PI43 Q6PI87 Q6PJF9 SeP
Symbols SeP
SELP
SEPP
SEPP1

Gene

 GO Function (1)

Gene RIF (65)

PMID Text
26675765 women who carry the SEPP1 rs3877899 A allele are better able to maintain selenium status during pregnancy, and their GPx3 activity increases more with supplementation, which suggests better protection from low selenium status.
26514640 Selenoprotein P concentrations are not elevated in women with gestational diabetes mellitus but are associated with BMI and HDL cholesterol.
26399395 Studied gene-specific regulation of hepatic selenoprotein expression by interleukin-6; by testing human hepatocytes in culture, found IL-6 reduced the concentrations of SePP mRNA and secreted SePP in a dose-dependent manner.
26348725 Impaired renal function is positively correlated with serum concentrations of SePP.
25395084 this study provide preliminary genetic evidence that the SEPP1 functional variants contribute to the AAA risk.
24914767 These results demonstrated that SelP interacts with tubulin, alpha 1a (TUBA1A).
24708917 Data suggest that plasma SEPP1 level can be up-regulated by dietary factors; here, significantly higher plasma SEPP1 is observed in women at risk of pre-eclampsia treated with dietary supplement of selenium-enriched yeast started in first trimester.
24638201 Elevated SeP concentrations are independently associated with a reduced risk of MetS in children
24563517 SEPP1 rs7579 was found to be associated with lower risk of advanced prostate cancer.
24437729 The histidine-rich domain of selenoprotein P is capable of binding Cu ions in both oxidation states of Cu(+) and Cu(2+) with high affinity and of modulating Cu(+) and Cu(2+)-mediated ABETA aggregation, reactive oxygen species production, neurotoxicity.
More...

AA Sequence

MWRSLGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASUYLCILQASKLE      1 - 70
DLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRC     71 - 140
GRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHH    141 - 210
HNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKR    211 - 280
CINQLLCKLPTDSELAPRSUCCHCRHLIFEKTGSAITUQCKENLPSLCSUQGLRAEENITESCQURLPPA    281 - 350
AUQISQQLIPTEASASURUKNQAKKUEUPSN                                           351 - 381
//

Text Mined References (86)

PMID Year Title
26675765 2016 Genetic polymorphisms that affect selenium status and response to selenium supplementation in United Kingdom pregnant women.
26514640 2015 Selenoprotein P is not elevated in gestational diabetes mellitus.
26399395 2015 Gene-specific regulation of hepatic selenoprotein expression by interleukin-6.
26348725 2015 Chronic Kidney Disease Distinctly Affects Relationship Between Selenoprotein P Status and Serum Thyroid Hormone Parameters.
25395084 2014 SEPP1 gene variants and abdominal aortic aneurysm: gene association in relation to metabolic risk factors and peripheral arterial disease coexistence.
24914767 2014 Direct interaction between selenoprotein P and tubulin.
24708917 2014 Effect of selenium on markers of risk of pre-eclampsia in UK pregnant women: a randomised, controlled pilot trial.
24638201 2014 Levels of circulating selenoprotein P, fibroblast growth factor (FGF) 21 and FGF23 in relation to the metabolic syndrome in young children.
24563517 2014 Selenoprotein gene variants, toenail selenium levels, and risk for advanced prostate cancer.
24437729 2014 Inhibitory effect of selenoprotein P on Cu(+)/Cu(2+)-induced A?42 aggregation and toxicity.
More...