Property Summary

NCBI Gene PubMed Count 40
Grant Count 17
R01 Count 12
Funding $799,881.16
PubMed Score 156.37
PubTator Score 664.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
26259531 Leukemia Relapse-Associated Mutation of NT5C2 Gene is Rare in de Novo Acute Leukemias and Solid Tumors.
25857773 Data indicate that type II cytosolic 5'-nucleotidase (cN-II) exerts a role in nucleotide and drug metabolism and regulating cell survival.
25811392 cN-II co-immunoprecipitated both with wild type Ipaf and its LRR domain after transfection with corresponding expression vectors, but not with Ipaf lacking the LRR domain.
24861553 Four novel body mass index-associated loci near the KCNQ1(rs2237892), ALDH2/MYL2 (rs671, rs12229654), ITIH4 (rs2535633) and NT5C2 (rs11191580) genes are identified in East Asian-ancestry populations.
23377281 results highlight the prominent role of relapse-specific mutations in NT5C2 as a mechanism of resistance to 6-Mercaptopurine and a genetic driver of relapse in acute lymphoblastic leukemia
23377183 These results suggest that mutations in NT5C2 are associated with the outgrowth of drug-resistant clones in acute lymphoblastic leukemia
23223233 analysis of Drosophila and human 7-methyl GMP-specific nucleotidases
22071413 Polymorphisms in the CYP17A1 and NT5C2 genes influence a reduction in both visceral and subcutaneous fat mass in Japanese women.
21396942 seven high-resolution structures of human cN-II, including a ligand-free form and complexes with various substrates and effectors, were presented.
21045733 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGF      1 - 70
ELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNK     71 - 140
FIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHY    141 - 210
KGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQ    211 - 280
SYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIG    281 - 350
DHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ    351 - 420
RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTV    421 - 490
EHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEE    491 - 560
E//

Text Mined References (45)

PMID Year Title
26259531 2016 Leukemia Relapse-Associated Mutation of NT5C2 Gene is Rare in de Novo Acute Leukemias and Solid Tumors.
25857773 2015 IMP-GMP specific cytosolic 5'-nucleotidase regulates nucleotide pool and prodrug metabolism.
25811392 2015 Cytosolic 5'-nucleotidase II interacts with the leucin rich repeat of NLR family member Ipaf.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
24001895 2013 Genome-wide association study meta-analysis reveals transethnic replication of mean arterial and pulse pressure loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
More...