Property Summary

NCBI Gene PubMed Count 15
Grant Count 3
R01 Count 3
Funding $296,695
PubMed Score 92.75
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.600 0.003
medulloblastoma, large-cell 1.600 0.000
diabetes mellitus 1.200 0.001
adult high grade glioma 1.100 0.004
ovarian cancer 1.500 0.000

Synonym

Accession P49901 Q96A42
Symbols MCS
MCSP
HSMCSGEN1

Gene

Gene RIF (2)

PMID Text
24244262 the initiation results indicate that an ectopically expressed variant form of SMCP has a role in tumor initiation of CSCs/CICs and that the variant form of SMCP might be a novel CSC/CIC marker
16325371 The levels of SMCP mRNA in human are much lower than in other mammals.

AA Sequence

MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQAR      1 - 70
CCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK                             71 - 116
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24244262 2013 Ectopically expressed variant form of sperm mitochondria-associated cysteine-rich protein augments tumorigenicity of the stem cell population of lung adenocarcinoma cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17047026 2006 Non-invasive genetic diagnosis of male infertility using spermatozoal RNA: KLHL10 mutations in oligozoospermic patients impair homodimerization.
16325371 2006 Comparative genomics of the sperm mitochondria-associated cysteine-rich protein gene.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11940662 2002 Asthenozoospermia in mice with targeted deletion of the sperm mitochondrion-associated cysteine-rich protein (Smcp) gene.
11375445 2001 Mammalian selenium-containing proteins.
More...