Property Summary

NCBI Gene PubMed Count 15
PubMed Score 96.57
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.100 3.6e-03
diabetes mellitus 1.200 1.1e-03
medulloblastoma, large-cell 1.600 9.3e-05
ovarian cancer 1.500 7.4e-12
psoriasis 1.100 5.0e-04

Synonym

Accession P49901 Q96A42
Symbols MCS
MCSP
HSMCSGEN1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQAR      1 - 70
CCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK                             71 - 116
//

Text Mined References (15)

PMID Year Title