Property Summary

NCBI Gene PubMed Count 52
PubMed Score 144.34
PubTator Score 59.40

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.652 0.009


  Ortholog (5)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken EggNOG Inparanoid

Gene RIF (36)

26947333 All these results indicate that the oxidative stress downregulates the conversion of T4 to T3 through DIO1 function in HepG2 cells.
25304215 Thyroid hormone deiodinases D1, D2, and D3 are differentially expressed in endothelial cells following thyroid hormone exposure.
24878678 [review] Deiodinase type 1 polymorphisms particularly show moderate-to-strong relationships with thyroid hormone parameters, insulin-like growth factor (IGF)1 protein production, and risk for depression.
24162265 The pattern of expression and role of triiodothyronine (T3) receptors and type I 5'-deiodinase in breast carcinomas, benign breast diseases, lactational change, and normal breast epithelium.
23462647 a new mechanism of posttranscriptional regulation of DIO1 and show deregulation of DIO1 expression in pituitary adenoma, possibly resulting from disturbed expression of SF2/ASF.
22544951 Data indicate that type 1 deiodinase is subject to catalysis-induced loss of activity.
22339181 D1-C785T polymorphism correlates with the severity of pre-eclampsia
22207295 investigation of DIO1 and DIO2 activities in 66 thyroid tissue samples from follicular thyroid adenoma, toxic diffuse goiter, nontoxic multinodular goiter, papillary thyroid carcinoma, and surrounding normal tissues
22067325 Short interfering RNA-mediated knockdown of FOXA1 decreased the expression of DIO1 mRNA, but knockdown of both FOXA1 and FOXA2 restored it.
21912701 a novel miRNA-mediated regulatory mechanism of Type 1 iodothyronine deiodinase expression in clear cell Renal Cell Carcinoma

AA Sequence

ALPERLYIIQEGRILYKGKSGPWNYNPEEVRAVLEKLHS                                   211 - 249

Text Mined References (52)

PMID Year Title
26947333 2016 Type 1 5'-deiodinase activity is inhibited by oxidative stress and restored by alpha-lipoic acid in HepG2 cells.
25304215 2015 Thyroid hormone deiodinases D1, D2, and D3 are expressed in human endothelial dermal microvascular line: effects of thyroid hormones.
24878678 2014 Genetics in endocrinology: genetic variation in deiodinases: a systematic review of potential clinical effects in humans.
24162265 2014 The pattern of expression and role of triiodothyronine (T3) receptors and type I 5'-deiodinase in breast carcinomas, benign breast diseases, lactational change, and normal breast epithelium.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
23462647 2013 Alternative splicing of iodothyronine deiodinases in pituitary adenomas. Regulation by oncoprotein SF2/ASF.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
22544951 2012 Catalysis leads to posttranslational inactivation of the type 1 deiodinase and alters its conformation.
22339181 2012 The effect of the D1-C785T polymorphism in the type 1 iodothyronine deiodinase gene on the circulating thyroid hormone levels in Romanian women with preeclampsia. Association with the degree of severity and pregnancy outcome of preeclampsia.
22207295 2012 Positive correlation between type 1 and 2 iodothyronine deiodinases activities in human goiters.