Property Summary

Ligand Count 1
NCBI Gene PubMed Count 56
PubMed Score 153.26
PubTator Score 59.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.652 9.2e-03

Gene RIF (40)

AA Sequence

MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQY      1 - 70
FWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCTUPSFMFKFDQFKRLI     71 - 140
EDFSSIADFLVIYIEEAHASDGWAFKNNMDIRNHQNLQDRLQAAHLLLARSPQCPVVVDTMQNQSSQLYA    141 - 210
ALPERLYIIQEGRILYKGKSGPWNYNPEEVRAVLEKLHS                                   211 - 249
//

Text Mined References (56)

PMID Year Title