Property Summary

NCBI Gene PubMed Count 19
PubMed Score 98.69
PubTator Score 31.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 4.12578645257715E-13
primary Sjogren syndrome 789 8.00958935319091E-5
cutaneous lupus erythematosus 1056 1.08874505468558E-4
osteosarcoma 7933 5.98879881295508E-4
invasive ductal carcinoma 2950 6.83587424055389E-4
lung cancer 4473 9.83473451842088E-4
head and neck cancer and chronic obstructive pulmonary disease 237 0.00135416904904879
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0020204594271439
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00257989987038563
interstitial cystitis 2299 0.0052111927594915
adult high grade glioma 2148 0.00549399432128325
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00695650735851757
type II diabetes mellitus and post-ischemic heart failure 89 0.0117478543402274
glioblastoma 5572 0.0125039285719545
ulcerative colitis 2087 0.0225017224700194
pancreatic cancer 2300 0.0343420332417842
pancreatic carcinoma 567 0.0343420332417842
mucosa-associated lymphoid tissue lymphoma 480 0.0376248965025614
Disease Target Count Z-score Confidence
Pityriasis rosea 2 4.13 2.1
Arts syndrome 6 3.828 1.9

Expression

Synonym

Accession P49863 B2R563
Symbols TRYP2

Gene

PDB

1MZA   1MZD  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG

Gene RIF (11)

PMID Text
25383893 Data indicate N-terminomics on the human and mouse granzymes A and K by combined fractional diagonal chromatography (COFRADIC).
24711407 Extracellular GrK is an unexpected direct modulator of lipopolysaccharide-TLR4 signaling during the antimicrobial innate immune response.
21666061 Granzyme K plays an important physiological role in immunoregulation of adaptive immunity underlying the cytotoxicity of CD56(bright) natural killer (NK) cells toward activated T cells.
20377743 Gr3 proenzymes is activated by cathepsin C which concomitantly decreased the molecular weight to that of active Gr3.
19201868 p53 is as a cytotoxic bomb that can be triggered by granzyme K, leading to potentiating killing efficacy.
19059912 GrK not only constitutes a redundant functional backup mechanism that assists GrA-induced cell death but that it also displays a unique function by cleaving its own specific substrates.
17438453 Rsults indicate that plasma levels of Granzyme K could serve as a useful diagnostic marker to stage sepsis, permitting better classification, specific treatments of patients, and may play a functional role in the development of sepsis.
17308307 GzmK-induced caspase-independent death occurs through Bid-dependent mitochondrial damage that is different from GzmA
17008916 We found human GzmK triggers rapid cell death independently of caspase activation. The features of death are characterized by rapid externalization of phosphatidylserine, nuclear morphological changes and single-stranded DNA nicks.
12387726 The present findings thus introduce the possibility that human beta-tryptase, after mast cell degranulation and exposure to neutral pH in the tissue, may dissociate into active monomers with properties that are distinct from the tetrameric counterpart.
More...

AA Sequence

MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQY      1 - 70
RFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSK     71 - 140
TSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSC    141 - 210
KGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN                    211 - 264
//

Text Mined References (20)

PMID Year Title
25383893 2014 Substrate specificities of the granzyme tryptases A and K.
24711407 2014 Granzyme K synergistically potentiates LPS-induced cytokine responses in human monocytes.
21666061 2011 Unexpected role for granzyme K in CD56bright NK cell-mediated immunoregulation of multiple sclerosis.
20377743 2010 Recombinant human progranzyme 3 expressed in Escherichia coli for analysis of its activation mechanism.
19201868 2009 Ignition of p53 bomb sensitizes tumor cells to granzyme K-mediated cytolysis.
19059912 2009 Granzyme K displays highly restricted substrate specificity that only partially overlaps with granzyme A.
17438453 2007 Altered levels and molecular forms of granzyme k in plasma from septic patients.
17308307 2007 Granzyme K directly processes bid to release cytochrome c and endonuclease G leading to mitochondria-dependent cell death.
17008916 2007 Granzyme K cleaves the nucleosome assembly protein SET to induce single-stranded DNA nicks of target cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...