Property Summary

NCBI Gene PubMed Count 65
Grant Count 28
R01 Count 26
Funding $3,417,203.67
PubMed Score 133.22
PubTator Score 102.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.700 0.010
ependymoma -2.000 0.013
oligodendroglioma -1.900 0.007
esophageal adenocarcinoma -2.700 0.023
psoriasis 1.800 0.000
osteosarcoma 1.020 0.000
glioblastoma -1.600 0.000
pancreatic cancer 2.200 0.001
Breast cancer -3.000 0.000
ovarian cancer 1.400 0.012

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
652039 screening 3330 / 0 / 365915 Fluorescence Intensity-based biochemical primary high throughput screening assay to identify activators of kallikrein-7 (K7) zymogen
652073 summary 0 / 0 / 0 Summary of the probe development effort to identify activators of kallikrein-7 (K7) zymogen
686949 screening 2186 / 0 / 1042 Fluorescence Intensity-based biochemical primary high throughput confirmation assay to identify activators of kallikrein-7 (K7) zymogen
720500 confirmatory 57 / 0 / 191 Fluorescence Intensity-based biochemical primary high throughput dose response assay to identify activators of kallikrein-7 (K7) zymogen

Gene RIF (54)

PMID Text
26231762 Data demonstrate that elevated levels of KLK6, KLK7 and KLK9 proteins are associated with poor glioblastoma patients survival.
26032414 Proteolytic cleavage of midkine, CYR61, and tenascin-C govern the pathophysiological roles of KLK7.
26022646 This report demonstrates that concurrent loss of KLK5 and KLK7 associates with a poor clinical outcome in Squamous-Cell Carcinoma and could therefore serve as prognostic marker in this disease.
25477184 KLK6 and KLK7 mRNA and protein overexpression is directly associated with early-stage ovarian tumors.
25448018 Daata indicate that the peptide Abz-NLY( downward arrow)RVE-Q-EDDnp is the best synthetic substrate for Kallikrein-related peptidase 7 (KLK7) [kcat/Km=455 (mMs)(-1)].
25182706 Our findings suggest that serum KLK7 may be a valuable diagnostic biomarker for cervical cancer, and may help to determine the individual prognosis of these patients.
25153388 These results demonstrate the aberrant expression of KLK7 in colon cancer cells and tissues and its involvement in cell proliferation in vitro and in vivo.
23495698 Prochemerin processing protease converts prochemerin into active chemerinF; the activating truncation by the protease may trigger a structural C-terminal rearrangement leading to increased affinity of chemerin to chemokine-like receptor (CMKLR)1.
23413953 Early-stage oral squamous cell carcinoma and high KLK7 mRNA levels were correlated with the rs10581213(wt/ins + ins/ins) genotypes
23224034 KLK7 and KLK14 gene expression can be regarded as markers of poor prognosis for colorectal cancer patients with discriminating power between CC and adenoma patients.
More...

AA Sequence

MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAH      1 - 70
CKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPP     71 - 140
GTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLV    141 - 210
CRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR                               211 - 253
//

Text Mined References (68)

PMID Year Title
26231762 2015 Prognostic significance of multiple kallikreins in high-grade astrocytoma.
26032414 2015 Novel Biological Substrates of Human Kallikrein 7 Identified through Degradomics.
26022646 2015 The Co-Expression of Kallikrein 5 and Kallikrein 7 Associates with Poor Survival in Non-HPV Oral Squamous-Cell Carcinoma.
25477184 2014 Kallikrein family proteases KLK6 and KLK7 are potential early detection and diagnostic biomarkers for serous and papillary serous ovarian cancer subtypes.
25448018 2015 Specificity studies on Kallikrein-related peptidase 7 (KLK7) and effects of osmolytes and glycosaminoglycans on its peptidase activity.
25182706 2014 Serum human kallikrein 7 represents a new marker for cervical cancer.
25153388 2014 Kallikrein-related peptidase 7 (KLK7) is a proliferative factor that is aberrantly expressed in human colon cancer.
23495698 2013 Proteolytic activation of prochemerin by kallikrein 7 breaks an ionic linkage and results in C-terminal rearrangement.
23413953 2013 Polymorphisms in Kallikrein7 and 10 genes and oral cancer risks in Taiwan betel quid chewers and smokers.
23370777 2013 Vaspin inhibits kallikrein 7 by serpin mechanism.
More...