Property Summary

NCBI Gene PubMed Count 48
PubMed Score 12.48
PubTator Score 20.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.300 0.000

Synonym

Accession P49848 A4D2B2 A4D2B3 B4DT11 D6W5U2 Q6AI29
Symbols ALYUS
TAF2E
TAFII70
TAFII80
TAFII85
MGC:8964
TAFII-70
TAFII-80
TAF(II)70
TAF(II)80

Gene

PANTHER Protein Class (1)

PDB

5FUR  

 MGI Term (1)

Gene RIF (19)

PMID Text
25025302 data point to several new RNA elements that can modulate TAF6delta and also reveal a role for RNA secondary structure in the selection of TAF6delta
23827503 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
23827503 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
22834489 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
22834489 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
22696218 TFIID TAF6-TAF9 complex formation involves the HEAT repeat-containing C-terminal domain of TAF6 and is modulated by TAF5 protein.
20096117 The transcriptome data uncovered novel links between TAF6delta expression and the Notch, oxidative stress response, integrin, p53, p53 feedback loop 2, and angiogenesis pathways.
18628956 TAF6delta has a pivotal node in a signaling pathway that controls gene expression programs and apoptosis in the absence of p53
15601843 histone fold domain mediated interaction enhances the DNA binding activity of each of the TAF6-TAF9 and TAF4b-TAF12 pairs and of a histone-like octamer complex composed of the four TAFs
15328371 a novel protein-protein interaction was observed between TAFII70 (not TAFII80) and GADD45a
More...

AA Sequence

MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSD      1 - 70
IDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEG     71 - 140
CQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKP    141 - 210
RSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLI    211 - 280
YLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNN    281 - 350
IQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGA    351 - 420
DHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPT    421 - 490
LTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSA    491 - 560
PGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPP    561 - 630
PASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP                           631 - 677
//

Text Mined References (57)

PMID Year Title
27007846 2016 Structure of promoter-bound TFIID and model of human pre-initiation complex assembly.
25025302 2014 Alternative splicing of TAF6: downstream transcriptome impacts and upstream RNA splice control elements.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22696218 2012 TFIID TAF6-TAF9 complex formation involves the HEAT repeat-containing C-terminal domain of TAF6 and is modulated by TAF5 protein.
21994455 2011 Generation and comprehensive analysis of an influenza virus polymerase cellular interaction network.
21269460 2011 Initial characterization of the human central proteome.
20457814 2010 Three key subregions contribute to the function of the downstream RNA polymerase II core promoter.
20096117 2010 TAF6delta orchestrates an apoptotic transcriptome profile and interacts functionally with p53.
More...