Property Summary

NCBI Gene PubMed Count 49
PubMed Score 12.84
PubTator Score 20.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
ALAZAMI-YUAN SYNDROME 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Disease Target Count
Cornelia De Lange Syndrome 1 3

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.300 2.2e-04

Gene RIF (17)

AA Sequence

MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSD      1 - 70
IDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEG     71 - 140
CQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKP    141 - 210
RSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLI    211 - 280
YLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNN    281 - 350
IQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGA    351 - 420
DHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPT    421 - 490
LTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSA    491 - 560
PGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPP    561 - 630
PASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP                           631 - 677
//

Text Mined References (61)

PMID Year Title