Property Summary

NCBI Gene PubMed Count 22
PubMed Score 71.63
PubTator Score 86.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma, Basal Cell 28 0.0 0.0
Disease Target Count
Basal cell carcinoma 54
Disease Target Count Z-score Confidence
Diarrhea 253 3.598 1.8

Expression

Gene RIF (7)

AA Sequence

MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGG      1 - 70
GDAGGTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLR     71 - 140
GEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAH    141 - 210
GIIFTEDYRTRVCDCVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQMTQTFGFRDSEITHLVNAGVL    211 - 280
TVRDAGSWWLAVPGAGRFIKYFVKGRQAVLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQ    281 - 350
LVDCISTTSGTLLRLPET                                                        351 - 368
//

Text Mined References (23)

PMID Year Title