Property Summary

Ligand Count 488
NCBI Gene PubMed Count 969
PubMed Score 610.78
PubTator Score 1876.17

Knowledge Summary

Patent (67,254)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.442 1.7

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.400 7.8e-06
astrocytoma 1.400 4.9e-03
atypical teratoid / rhabdoid tumor -1.300 1.6e-05
Breast cancer 2.200 4.8e-02
ependymoma -1.400 2.6e-02
glioblastoma -1.200 6.8e-09
group 4 medulloblastoma 1.700 2.5e-03
intraductal papillary-mucinous adenoma (... 1.200 1.1e-03
intraductal papillary-mucinous carcinoma... 1.300 1.0e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.1e-02
medulloblastoma, large-cell -1.200 1.0e-04
oligodendroglioma 1.300 1.7e-03
osteosarcoma -1.150 1.2e-03
ovarian cancer -1.200 8.9e-05
Pick disease 1.700 7.3e-05
psoriasis -1.400 3.8e-04
spina bifida -1.051 4.8e-02
subependymal giant cell astrocytoma -1.187 3.8e-02
tuberculosis 1.200 2.1e-05

Synonym

Accession P49841 D3DN89 Q9BWH3 Q9UL47 GSK-3 beta
Symbols

Gene

PDB

1O9U   3ZDI   4B7T   4NM0   4NM3   4NM5   4NM7   1GNG   1H8F   1I09   1J1B   1J1C   1O6K   1O6L   1PYX   1Q3D   1Q3W   1Q41   1Q4L   1Q5K   1R0E   1UV5   2JDO   2JDR   2JLD   2O5K   2OW3   2UW9   2X39   2XH5   3CQU   3CQW   3DU8   3E87   3E88   3E8D   3F7Z   3F88   3GB2   3I4B   3L1S   3M1S   3MV5   3OW4   3PUP   3Q3B   3QKK   3SAY   3SD0   3ZRK   3ZRL   3ZRM   4ACC   4ACD   4ACG   4ACH   4AFJ   4DIT   4EKK   4IQ6   4J1R   4J71   4PTC   4PTE   4PTG   5F94   5F95   5HLN   5HLP   5K5N   5OY4   6B8J  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (827)

AA Sequence

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVV      1 - 70
YQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVY     71 - 140
RVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG    141 - 210
EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ    211 - 280
IREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKL    281 - 350
PNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST    351 - 420
//

Text Mined References (994)

PMID Year Title