Property Summary

NCBI Gene PubMed Count 865
Grant Count 331
R01 Count 198
Funding $35,909,843.12
PubMed Score 567.70
PubTator Score 1876.17

Knowledge Summary

Patent (67,254)

Expression

  Differential Expression (19)

Synonym

Accession P49841 D3DN89 Q9BWH3 Q9UL47 GSK-3 beta
Symbols

Gene

PDB

1O9U   3ZDI   4B7T   4NM0   4NM3   4NM5   4NM7   1GNG   1H8F   1I09   1J1B   1J1C   1O6K   1O6L   1PYX   1Q3D   1Q3W   1Q41   1Q4L   1Q5K   1R0E   1UV5   2JDO   2JDR   2JLD   2O5K   2OW3   2UW9   2X39   2XH5   3CQU   3CQW   3DU8   3E87   3E88   3E8D   3F7Z   3F88   3GB2   3I4B   3L1S   3M1S   3MV5   3OW4   3PUP   3Q3B   3QKK   3SAY   3SD0   3ZRK   3ZRL   3ZRM   4ACC   4ACD   4ACG   4ACH   4AFJ   4DIT   4EKK   4IQ6   4J1R   4J71   4PTC   4PTE   4PTG   5F94   5F95   5HLN   5HLP   5K5N  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2097 screening 116 / 0 / 302387 Cell-Free Homogeneous Primary HTS to Identify Inhibitors of GSK3beta Activity
2119 summary 0 / 0 / 0 Summary of Probe Development Efforts to Identify Inhibitors of Glycogen Synthase Kinase-3 beta (GSK-3b)
434954 confirmatory 581 / 12 / 1605 Luminescence Cell-Free Homogeneous Dose Retest to Identify Inhibitors of Glycogen Synthase Kinase-3 beta Activity
588406 confirmatory 16 / 0 / 0 Inhibition of Human GSK-3 beta Activity Measured in Biochemical System Using Microfluidics - 2063-05_Inhibitor_Dose_DryPowder_Activity
588429 confirmatory 25 / 1 / 0 Inhibition of Human GSK-3 beta Activity Measured in Biochemical System Using Microfluidics - 2063-05_Inhibitor_Dose_DryPowder_Activity_Set2
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
602272 confirmatory 1 / 0 / 36 Inhibition of Human GSK3 beta Activity Measured in Biochemical System Using Plate Reader - 2083-02_Inhibitor_Dose_DryPowder_Activity
623989 confirmatory 21 / 2 / 1 Inhibition of Human GSK3 beta Activity Measured in Biochemical System Using Microfluidics - 2046-10_Inhibitor_Dose_DryPowder_Activity_Set2
623998 confirmatory 81 / 6 / 3 GSK3beta Measured in Biochemical System Using Plate Reader - 2046-01_Inhibitor_Dose_DryPowder_Activity
More...

Gene RIF (735)

PMID Text
26850078 MPT induced by MF exposure was mediated through the ROS/GSK-3beta signaling pathway.
26845447 TSSC3 downregulation promotes the Epithelial to mesenchymal transition (EMT) of osteosarcoma cells by regulating EMT markers via a signal transduction pathway that involves Snail, Wnt-beta-catenin/TCF, and GSK-3beta
26826001 overexpression of the IGF-1R, and activation of GSK3beta and FOXO3a might be the molecular mechanisms underlying the development of liver cirrhosis
26822034 The induction of GSK3B phosphorylation by DNA double-strand breaks through ATM as a unique mechanism to attenuate the activity of nuclear GSK3beta and promote survival of cells is reported.
26766591 reveals that GSK-3alpha- and GSK-3beta-regulated pathways can be responsible for stepwise transition to myelodysplastic syndromes and subsequent acute myeloid leukemia
26711256 The PKC-zeta - induced phosphorylation of GSK-3 beta stimulates GSK-3 beta activity.
26707164 binding between AMPK and b-catenin occurs in the cytosolic fraction, and therefore concluded that the cancer cell antiproliferative effects of selenium are mediated by a GSK3b-independent AMPK/b-catenin pathway
26707073 CD151 knockdown inhibits the expression of MMP9 through the GSK-3b/bcatenin pathway and also inhibits Osteosarcoma (OS)migration and invasion in vitro and metastasis in vivo in highly metastatic OS.
26631736 There was 25% lower inhibitory phosphorylation of GSK-3beta in umbilical cord MSCs from obese mothers compared to cord MSCs from normal weight mothers.
26618897 Study provides evidence that GSK3beta activity can be compromised in cartilage of obese osteoarthritis patients and show its requirement for chondrocyte mitochondrial function and prevention of oxidative damage, hypertrophy and senescence.
More...

AA Sequence

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVV      1 - 70
YQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVY     71 - 140
RVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG    141 - 210
EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ    211 - 280
IREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKL    281 - 350
PNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST    351 - 420
//

Text Mined References (889)

PMID Year Title
26850078 2016 Exposure to a 50-Hz magnetic field induced mitochondrial permeability transition through the ROS/GSK-3? signaling pathway.
26845447 2016 Downregulation of tumor suppressing STF cDNA 3 promotes epithelial-mesenchymal transition and tumor metastasis of osteosarcoma by the Wnt/GSK-3?/?-catenin/Snail signaling pathway.
26826001 2016 Hepatic IGF-1R overexpression combined with the activation of GSK-3? and FOXO3a in the development of liver cirrhosis.
26822034 2016 Inactivation of nuclear GSK3? by Ser(389) phosphorylation promotes lymphocyte fitness during DNA double-strand break response.
26766591 2016 GSK3 Deficiencies in Hematopoietic Stem Cells Initiate Pre-neoplastic State that Is Predictive of Clinical Outcomes of Human Acute Leukemia.
26711256 2015 Glycogen Synthase Kinase 3? Is Positively Regulated by Protein Kinase C?-Mediated Phosphorylation Induced by Wnt Agonists.
26707164 2016 AMPK interacts with ?-catenin in the regulation of hepatocellular carcinoma cell proliferation and survival with selenium treatment.
26707073 2016 CD151 knockdown inhibits osteosarcoma metastasis through the GSK-3?/?-catenin/MMP9 pathway.
26631736 2016 Mesenchymal Stem Cells From Infants Born to Obese Mothers Exhibit Greater Potential for Adipogenesis: The Healthy Start BabyBUMP Project.
26618897 2015 Lithium Chloride Dependent Glycogen Synthase Kinase 3 Inactivation Links Oxidative DNA Damage, Hypertrophy and Senescence in Human Articular Chondrocytes and Reproduces Chondrocyte Phenotype of Obese Osteoarthritis Patients.
More...