Property Summary

NCBI Gene PubMed Count 111
Grant Count 74
R01 Count 58
Funding $5,658,072.75
PubMed Score 52.32
PubTator Score 143.91

Knowledge Summary

Patent (6,631)

Expression

Synonym

Accession P49840 O14959 GSK-3 alpha
Symbols

Gene

PDB

2DFM  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2650 screening 318 / 1 / 315189 Luminescence Cell-Free Homogenous Primary HTS to Identify Inhibitors of GSK-3 alpha
2709 summary 0 / 0 / 0 Summary of Broad Institute MLPCN Glycogen Synthase Kinase-3 alpha Project
463203 confirmatory 769 / 18 / 1565 Luminescence Cell-Free Homogeneous Dose Retest to Confirm Inhibitors of GSK-3 alpha
588361 confirmatory 15 / 1 / 0 Inhibition of Human GSK-3 alpha Activity Measured in Biochemical System Using Microfluidics - 2063-06_Inhibitor_Dose_DryPowder_Activity
588434 confirmatory 25 / 1 / 0 Inhibition of Human GSK-3 alpha Activity Measured in Biochemical System Using Microfluidics - 2063-06_Inhibitor_Dose_DryPowder_Activity_Set2
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
623978 confirmatory 18 / 3 / 3 Inhibition of Human GSK3 alpha Activity Measured in Biochemical System Using Microfluidics - 2046-11_Inhibitor_Dose_DryPowder_Activity_Set2
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (78)

PMID Text
27049759 demonstrated that GSK-3alpha is regulated by CREB in lung cancer and is required for the cell viability. These findings implicate CREB-GSK-3alpha axis as a novel therapeutic target for lung cancer treatment
26766591 reveals that GSK-3alpha- and GSK-3beta-regulated pathways can be responsible for stepwise transition to myelodysplastic syndromes and subsequent acute myeloid leukemia
26393419 GSK3 acts through APC motifs R2 and B to regulate APC:Axin interactions, promoting high-throughput of betacatenin to destruction.
25935310 CHP3 functions as a novel negative regulator of cardiomyocyte hypertrophy via inhibition of GSK3alpha/beta phosphorylation.
25561726 Data indicate that autophagy inhibition promotes glycogen synthase kinase-(GSK3) inhibition-induced apoptosis.
25550525 glycogen synthase kinase 3 alpha and beta activity is increased in foetal membranes after term and preterm labour
25486534 Elevated GSK3 protein kinase activity is associated with non-small cell lung carcinoma
25187516 PtpA has a role in promoting anti-apoptotic activity of protein-dependent dephosphorylation of host GSK3alpha
25183803 ER stress-PERK-GSK3alpha/beta signaling promotes proatherogenic macrophage lipid accumulation
24984063 GSK3A is redundant with GSK3B in regulating drug-resistance and chemotherapy-induced necroptosis
More...

AA Sequence

MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPG      1 - 70
GSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAE     71 - 140
TRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFT    141 - 210
KAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYI    211 - 280
CSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPN    281 - 350
YTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP    351 - 420
PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS           421 - 483
//

Text Mined References (123)

PMID Year Title
27049759 2016 GSK-3? Is a Novel Target of CREB and CREB-GSK-3? Signaling Participates in Cell Viability in Lung Cancer.
26766591 2016 GSK3 Deficiencies in Hematopoietic Stem Cells Initiate Pre-neoplastic State that Is Predictive of Clinical Outcomes of Human Acute Leukemia.
26393419 2015 A novel GSK3-regulated APC:Axin interaction regulates Wnt signaling by driving a catalytic cycle of efficient ?catenin destruction.
25935310 2015 Calcineurin B homologous protein 3 negatively regulates cardiomyocyte hypertrophy via inhibition of glycogen synthase kinase 3 phosphorylation.
25561726 2015 Glycogen synthase kinase-3 (GSK3) inhibition induces prosurvival autophagic signals in human pancreatic cancer cells.
25550525 2015 A novel role for GSK3 in the regulation of the processes of human labour.
25486534 2014 Glycogen synthase kinase 3 protein kinase activity is frequently elevated in human non-small cell lung carcinoma and supports tumour cell proliferation.
25187516 2014 Mycobacterium tuberculosis promotes anti-apoptotic activity of the macrophage by PtpA protein-dependent dephosphorylation of host GSK3?.
25183803 2014 Protein kinase R-like endoplasmic reticulum kinase and glycogen synthase kinase-3?/? regulate foam cell formation.
24984063 2014 GSK3A is redundant with GSK3B in modulating drug resistance and chemotherapy-induced necroptosis.
More...