Property Summary

Ligand Count 7
NCBI Gene PubMed Count 197
PubMed Score 585.93
PubTator Score 370.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-03

Protein-protein Interaction (2)

Gene RIF (139)

AA Sequence

MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPG      1 - 70
RPPGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVL     71 - 140
NTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLLLTVWN    141 - 210
FGAVGMVCIHWKGPLVLQQAYLIMISALMALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVET    211 - 280
AQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGE    281 - 350
ELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISI    351 - 420
TFGLIFYFSTDNLVRPFMDTLASHQLYI                                              421 - 448
//

Text Mined References (203)

PMID Year Title