Property Summary

NCBI Gene PubMed Count 45
Grant Count 32
R01 Count 20
Funding $3,046,053.11
PubMed Score 45.64
PubTator Score 36.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma 1.200 0.023
osteosarcoma -1.436 0.000
posterior fossa group B ependymoma 1.300 0.000
subependymal giant cell astrocytoma 1.119 0.009
ovarian cancer 2.100 0.000

 GO Function (1)

Gene RIF (18)

PMID Text
26416661 Our data provide a novel miR-25/RGS3 signal in the development of lung cancer.
24375609 cardiac overexpression of RGS3 inhibits maladaptive hypertrophy and fibrosis and improves cardiac function by blocking MEK-ERK1/2 signaling
24297163 ectopic expression of R4 subfamily members RGS2, RGS3, RGS4, and RGS5 reduced activated PAR1 wild-type signaling, whereas signaling by the PAR1 AKKAA mutant was minimally affected.
22859293 PDZ-RGS3 can enhance signals generated by the Wnt canonical pathway and plays a pivotal role in epithelial mesenchymal transition
22027839 Results suggest that the 14-3-3 protein binding affects the structure of the Galpha interaction portion of RGS3 as well as sterically blocks the interaction between the RGS domain and the Galpha subunit of heterotrimeric G proteins.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627871 Observational study of gene-disease association. (HuGE Navigator)
20347994 14-3-3 protein binding induces structural changes in both the N-terminal part and the C-terminal RGS domain of phosphorylated RGS3 molecule
19913121 Observational study of gene-disease association. (HuGE Navigator)
19778949 Regulator of G-protein signalling 3 (RGS3) showed a difference between follicular cells from follicles leading to a pregnancy or developmental failure.
More...

AA Sequence

MPVIPALWEVEMGRSQGQEIETILANRSHSDSTPLPNFLSGSHRPECCTCRLLTASGAQDSLPFGRRLYS      1 - 70
GPWRSCEEVCHVSVLSVLSTSCGLSLSLPIFPGWMEWLSPDIALPRRDEWTQTSPARKRITHAKVQGAGQ     71 - 140
LRLSIDAQDRVLLLHIIEGKGLISKQPGTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHFFFPVQ    141 - 210
EEDDQKRLLVTVWNRASQSRQSGLIGCMSFGVKSLLTPDKEISGWYYLLGEHLGRTKHLKVARRRLRPLR    211 - 280
DPLLRMPGGGDTENGKKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVE    281 - 350
HWKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGVQARPEQ    351 - 420
RHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQLLRPVYQEDTI    421 - 490
PEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVRPHATHSSYGTYVTLAPKVLVFPVFVQPL    491 - 560
DLCNPARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLK    561 - 630
FCVLYLAEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPG    631 - 700
AEDSPPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDVPPCQEP    701 - 770
PPAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLL    771 - 840
AATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDEDTSDDNYGER    841 - 910
SEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDTTLHCSDGEGAASTWGMPSPS    911 - 980
TLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAKDMKNKLGIFRRRNESPGAPPA    981 - 1050
GKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAS   1051 - 1120
KAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLIN   1121 - 1190
QKKMSPPL                                                                 1191 - 1198
//

Text Mined References (50)

PMID Year Title
26416661 2016 Elevated microRNA-25 inhibits cell apoptosis in lung cancer by targeting RGS3.
25416956 2014 A proteome-scale map of the human interactome network.
24375609 2014 Regulator of G protein signaling 3 protects against cardiac hypertrophy in mice.
24297163 2014 Regulation of protease-activated receptor 1 signaling by the adaptor protein complex 2 and R4 subfamily of regulator of G protein signaling proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23464602 2013 RGS expression in cancer: oncomining the cancer microarray data.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22859293 2012 Regulator of G-protein signaling 3 isoform 1 (PDZ-RGS3) enhances canonical Wnt signaling and promotes epithelial mesenchymal transition.
22699066 2012 [Identification of differentially expressed genes related to blastic crisis in chronic myeloid leukemia].
More...