Property Summary

NCBI Gene PubMed Count 297
Grant Count 140
R01 Count 67
Funding $22,872,400.42
PubMed Score 769.66
PubTator Score 752.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.693 0.000
Common variable immunodeficiency -1.219 0.008
sarcoidosis -1.300 0.002
inflammatory breast cancer -1.200 0.000

Synonym

Accession P49789 A2IAS9 A2IAT0 A2IAT6 A8K1A9 Q45QG9 Q6IU12
Symbols FRA3B
AP3Aase

Gene

PDB

1FHI   1FIT   2FHI   2FIT   3FIT   4FIT   5FIT   6FIT  

Gene RIF (248)

PMID Text
27060312 Mutations of the FHIT gene are not major cause of Peutz-Jeghers syndrome.
26929601 FHIT hypermethylation, which induces the inactivation of FHIT gene, plays an important role in the carcinogenesis and clinical outcome and may serve as a potential diagnostic marker and drug target of non-small-cell lung carcinoma
26745060 Low FHIT Gene Expression is associated with Acute Lymphoblastic Leukemia.
26491255 Review/Meta-analysis: FHIT methylation could be a diagnostic biomarker of breast carcinogenesis.
26406001 The results showed that the methylation levels of both BRCA1 and FHIT promoters were higher in the serum of the breast ductal carcinoma group than those of the breast fibroadenoma group.
26181368 Adenylylsulfate-ammonia adenylyltransferase activity is another inherent property of Fhit proteins.
25735361 FHIT promotor hypermethylation is associated with the development of breast cancer.
25720522 Hypermethylation of FHIT gene is associated with Epstein-Barr virus-associated gastric carcinomas.
25711523 Fhit nuclear translocation upon mitogenic stimulation may represent a new regulatory mechanism that allows rapid restoration of Fhit cytoplasmic levels and promotes the proliferation cascade activated by mitogenic stimulation
25486479 Data are consistent with a mechanism in which Fhit protein is required for accumulation of the transcriptional repressor of HMOX1, Bach1 protein.
More...

AA Sequence

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE      1 - 70
KHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAA     71 - 140
ALRVYFQ                                                                   141 - 147
//

Text Mined References (298)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27060312 2016 [Mutations of the STK11 and FHIT genes among patients with Peutz-Jeghers syndrome].
26929601 2016 The clinicopathological significance and ethnic difference of FHIT hypermethylation in non-small-cell lung carcinoma: a meta-analysis and literature review.
26745060 2015 FHIT Gene Expression in Acute Lymphoblastic Leukemia and its Clinical Significance.
26491255 2015 The clinicopathological significance and drug target potential of FHIT in breast cancer, a meta-analysis and literature review.
26406001 2015 Quantitative detection of methylation of FHIT and BRCA1 promoters in the serum of ductal breast cancer patients.
26181368 2015 Adenylylsulfate-ammonia adenylyltransferase activity is another inherent property of Fhit proteins.
25735361 2015 Analysis of FHIT gene methylation in egyptian breast cancer women: association with clinicopathological features.
25720522 2015 Aberrant gene promoter methylation of p16, FHIT, CRBP1, WWOX, and DLC-1 in Epstein-Barr virus-associated gastric carcinomas.
25711523 2015 Fhit Nuclear Import Following EGF Stimulation Sustains Proliferation of Breast Cancer Cells.
More...