Property Summary

Ligand Count 5
NCBI Gene PubMed Count 307
PubMed Score 789.63
PubTator Score 752.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Common variable immunodeficiency -1.219 8.3e-03
inflammatory breast cancer -1.200 1.5e-04
osteosarcoma -1.693 7.4e-06
sarcoidosis -1.300 2.1e-03

Protein-protein Interaction (1)

Gene RIF (258)

AA Sequence

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE      1 - 70
KHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAA     71 - 140
ALRVYFQ                                                                   141 - 147
//

Text Mined References (308)

PMID Year Title