Property Summary

NCBI Gene PubMed Count 26
PubMed Score 25.02
PubTator Score 83.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
24014597 High TIG1 expression is associated with inflammatory breast cancer through activation of Axl kinase.
24006221 our data suggested that epigenetic silencing of TIG1 gene expression by promoter hypermethylation may play an important role in hepatocellular carcinoma .
22942771 All-trans retinoic acid modulated secretion of RARRES1 in a dose dependent manner.
22669512 Analysis of a standard liver fibrosis model (CCl(4)) demonstrated an early induction of RARRES1 mRNA and protein expression.
22615834 Knocking-down CTCF expression hampered RARRES1 expression.
22573467 genotype-associated hypermethylation of the ETS-family target gene RARRES1 influences methylation at its neighbor gene LXN and could be useful as a prognostic biomarker.
22126303 TIG1 suppressed PGE2-stimulated Wnt and cAMP signaling pathways in colon cancer cells through GRK5.
21575264 GRK5 mediates cell growth suppression by TIG1A. Thus, TIG1 may participate in the downregulation of G-protein coupled signaling by upregulating GRK5 expression.
21303978 RARRES1, its interacting partners AGBL2, Eg5/KIF11, another EEY-bearing protein (EB1), and the microtubule tyrosination cycle are important in tumorigenesis.
21168224 The results of this study suggested that short RAI1 alleles might be releated to schizophreina disease.
More...

AA Sequence

MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFF      1 - 70
NFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPT     71 - 140
INVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQV    141 - 210
SHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGT    211 - 280
EEGSAVVPTELSNF                                                            281 - 294
//

Text Mined References (27)

PMID Year Title
24014597 2013 TIG1 promotes the development and progression of inflammatory breast cancer through activation of Axl kinase.
24006221 2014 Aberrant TIG1 methylation associated with its decreased expression and clinicopathological significance in hepatocellular carcinoma.
22942771 2012 Secretome survey of human plexiform neurofibroma derived Schwann Cells reveals a secreted form of the RARRES1 protein.
22669512 2012 Identification of RARRES1 as a core regulator in liver fibrosis.
22615834 2012 Epigenetic repression of RARRES1 is mediated by methylation of a proximal promoter and a loss of CTCF binding.
22573467 2012 The SNP rs6441224 influences transcriptional activity and prognostically relevant hypermethylation of RARRES1 in prostate cancer.
22126303 2011 Tazarotene-induced gene 1 inhibits prostaglandin E2-stimulated HCT116 colon cancer cell growth.
21575264 2011 G protein-coupled receptor kinase 5 mediates Tazarotene-induced gene 1-induced growth suppression of human colon cancer cells.
21303978 2011 Tumor suppressor RARRES1 interacts with cytoplasmic carboxypeptidase AGBL2 to regulate the ?-tubulin tyrosination cycle.
21168224 2011 Retinoic acid induced 1 gene and clinical subtypes of schizophrenia: an association study.
More...