Property Summary

NCBI Gene PubMed Count 29
PubMed Score 27.33
PubTator Score 83.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
active Crohn's disease 1.832 8.1e-03
adrenocortical carcinoma -1.765 6.1e-03
adult high grade glioma 2.100 1.1e-05
Astrocytoma, Pilocytic 1.200 4.2e-04
Atopic dermatitis -1.900 1.2e-03
atypical teratoid/rhabdoid tumor 1.100 2.2e-04
Breast cancer -2.700 1.2e-06
colon cancer -1.500 8.1e-03
cutaneous lupus erythematosus 1.500 4.2e-02
cystic fibrosis 1.311 5.5e-04
ductal carcinoma in situ 2.100 1.5e-02
ependymoma 1.600 1.9e-03
esophageal adenocarcinoma 2.000 2.0e-02
gastric carcinoma 3.000 2.6e-02
glioblastoma 1.200 1.6e-04
interstitial cystitis 1.700 4.5e-02
intraductal papillary-mucinous adenoma (... -1.600 4.0e-03
invasive ductal carcinoma 2.400 4.7e-02
lung cancer -2.000 8.8e-05
lung carcinoma -1.100 5.5e-11
malignant mesothelioma -4.400 9.8e-08
medulloblastoma 1.200 1.3e-02
non primary Sjogren syndrome sicca 1.100 3.0e-02
osteosarcoma 1.111 3.6e-02
ovarian cancer -4.100 6.2e-09
pancreatic cancer 1.500 1.7e-03
pituitary cancer -2.800 5.1e-05
primary pancreatic ductal adenocarcinoma 1.443 1.7e-03
psoriasis -1.400 1.9e-02
pterygium -1.500 3.9e-02
type II diabetes mellitus and post-ische... -1.100 3.7e-02

Gene RIF (20)

AA Sequence

MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFF      1 - 70
NFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPT     71 - 140
INVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQV    141 - 210
SHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGT    211 - 280
EEGSAVVPTELSNF                                                            281 - 294
//

Text Mined References (30)

PMID Year Title