Property Summary

NCBI Gene PubMed Count 56
PubMed Score 379.46
PubTator Score 274.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count Z-score Confidence
Neuropathy 261 0.0 4.0
Disease Target Count
Gamstorp-Wohlfart syndrome 1

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.400 2.9e-02
astrocytoma -1.500 1.4e-03
diabetes mellitus -1.100 5.9e-03
lung cancer -3.500 4.3e-02
Multiple myeloma 2.037 6.4e-04
ovarian cancer -1.200 8.3e-05
pancreatic ductal adenocarcinoma liver m... -2.136 1.3e-02
Waldenstrons macroglobulinemia 1.323 2.7e-02

Protein-protein Interaction (4)

Gene RIF (41)

AA Sequence

MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDD      1 - 70
ESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG                   71 - 126
//

Text Mined References (61)

PMID Year Title