Property Summary

NCBI Gene PubMed Count 51
PubMed Score 346.49
PubTator Score 274.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.323 0.027
Multiple myeloma 2.037 0.001
astrocytoma -1.500 0.001
pancreatic ductal adenocarcinoma liver m... -2.136 0.013
lung cancer -3.500 0.043
diabetes mellitus -1.300 0.001
acute myeloid leukemia -1.400 0.029
ovarian cancer -1.500 0.000

Synonym

Accession P49773 Q9H5W8
Symbols HINT
NMAN
PKCI-1
PRKCNH1

Gene

PDB

1AV5   1KPA   1KPB   1KPC   1KPE   1KPF   3TW2   4EQE   4EQG   4EQH   4ZKL   4ZKV   5I2E   5I2F  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid

Pathway (1)

Gene RIF (36)

PMID Text
26520111 In hepatocellular carcinoma, HINT1 is a regulator of IkappaBalpha through SCF(beta-TrCP) E3 ligase.
26194197 Absence of HINT1 mutations in a UK and Spanish cohort of patients with inherited neuropathies
25648896 The teneurin-1 intracellular domain binds HINT1, thus switching on MITF-dependent transcription of GPNMB.
25342199 HINT1 mutations seem to be one of the most frequent causes of inherited neuropathy and are probably the most frequent cause of HMN in Czech patients. We suggest all HMN/CMT2 patients be tested for the presence of the prevalent mutation, the p.R37P
24447405 Study gives suggestive evidence that HINT1 rs3852209 may be related to smoking status in Chinese men.
24386364 BTF3, HINT1, NDRG1 and ODC1 protein over-expression in human prostate cancer tissue
24105373 Data suggest that histidine triad nucleotide binding protein 1 (HINT1) should be added to the list of genes to check for in distal hereditary motor neuropathies (dHMNs).
23769013 Histidine triad nucleotide-binding protein 1, bifunctional aminoacyl-tRNA synthetase, and clusterin precursor protein may serve as potential biomarkers distinguishing type 2 diabetes mellitus patients from healthy controls.
23614568 hHint1 catalyzes the hydrolysis of phosphoramidate and acyl adenylate with high efficiency.
23166591 Expression of HIV-1 Tat upregulates the abundance of histidine triad nucleotide binding protein 1 (HINT1) in the nucleoli of Jurkat T-cells
More...

AA Sequence

MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDD      1 - 70
ESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG                   71 - 126
//

Text Mined References (56)

PMID Year Title
26520111 2016 Hint1 Up-Regulates I?B? by Targeting the ?-TrCP Subunit of SCF E3 Ligase in Human Hepatocellular Carcinoma Cells.
26194197 2015 Absence of HINT1 mutations in a UK and Spanish cohort of patients with inherited neuropathies.
25648896 2015 The intracellular domain of teneurin-1 induces the activity of microphthalmia-associated transcription factor (MITF) by binding to transcriptional repressor HINT1.
25342199 2015 Mutations in HINT1 are one of the most frequent causes of hereditary neuropathy among Czech patients and neuromyotonia is rather an underdiagnosed symptom.
24447405 2014 Association between common genetic variants in the opioid pathway and smoking behaviors in Chinese men.
24386364 2013 Quantitative analysis of BTF3, HINT1, NDRG1 and ODC1 protein over-expression in human prostate cancer tissue.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105373 2014 Exome sequencing reveals HINT1 mutations as a cause of distal hereditary motor neuropathy.
23769013 2013 Identification of urinary biomarkers for type 2 diabetes using bead-based proteomic approach.
23614568 2013 Kinetic mechanism of human histidine triad nucleotide binding protein 1.
More...