Property Summary

NCBI Gene PubMed Count 366
PubMed Score 978.70
PubTator Score 780.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 2.72996861602409E-9
psoriasis 6685 3.95213400490268E-8
malignant mesothelioma 3163 4.52789073432582E-7
cystic fibrosis 1670 9.11384906231116E-6
ovarian cancer 8492 1.87560001832242E-4
pituitary cancer 1972 3.21620554689392E-4
osteosarcoma 7933 3.9568734917304E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00147702105270643
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00328992784781429
aldosterone-producing adenoma 664 0.00687670194406204
gastric carcinoma 832 0.00711003167861212
fibroadenoma 557 0.00829248212811618
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0159701579466846
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
Lymphedema, hereditary, 1D 1

Expression

Synonym

Accession P49767 B2R9Q8 VEGF-C
Symbols VRP
Flt4-L
LMPH1D

Gene

PANTHER Protein Class (2)

PDB

2X1W   2X1X   4BSK  

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 CSPA Cell Line (1)

Gene RIF (353)

PMID Text
26753562 the concurrent high expression of VEGF-C and NRP2 is predictive of the unfavorable prognosis in glioblastoma.
26750536 Our data suggested that IL-6 mediates the singnal pathway of JAK-STAT3-VEGF-C promoting the growth, invasion and lymphangiogenesis in gastric cancer
26706909 The most extensively accepted signaling pathways promoting lymphangiogenesis in tumors include the secreted lymphangiogenic proteins: VEGF-C and VEGF-D, and their cognate receptor on lymphatic endothelium VEGF receptor-3 (VEGFR-3).
26573417 a significant decrease in miR101 levels, accompanied with an increased expression of vascular endothelial growth factor (VEGF)C in cisplatinresistant SGC7901 gastric cancer cells.
26543080 MTA1 is up-regulated in CRC; its expression is inversely associated with lymphatic metastases and the expression of VEGFC, VEGFD and VEGFR3
26467187 Human lung-resident macrophages express CB1 and CB2 receptors whose activation inhibits the release of angiogenic and lymphangiogenic factors
26460960 miR-27b, miR-101 and miR-128 inhibit angiogenesis by down-regulating VEGF-C expression in gastric cancers.
26443563 VEGF-C plays a crucial role in tumor lymphangiogenesis and lymph node metastasis of ovarian cancer.
26339369 PKM2 expression was correlated with VEGF-C expression, and combination of PKM2 and VEGF-C levels had the better prognostic significance in predicting the poor outcome of patients with breast cancer.
26313304 Vascular endothelial growth factor-A, -C and -D mRNA, and VEGF-A and -D protein were expressed by all CM and UM cell lines, while VEGF-C protein was only expressed by UM cell lines.
More...

AA Sequence

MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELM      1 - 70
TVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDV     71 - 140
GKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCR    141 - 210
CMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDIC    211 - 280
GPNKELDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRN    281 - 350
QPLNPGKCACECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS     351 - 419
//

Text Mined References (368)

PMID Year Title
26753562 2016 Concurrent Expression of VEGF-C and Neuropilin-2 Is Correlated with Poor Prognosis in Glioblastoma.
26750536 2016 IL-6 mediates the signal pathway of JAK-STAT3-VEGF-C promoting growth, invasion and lymphangiogenesis in gastric cancer.
26706909 2016 IGFBP7 functions as a potential lymphangiogenesis inducer in non-small cell lung carcinoma.
26573417 2016 MicroRNA-101 induces apoptosis in cisplatin-resistant gastric cancer cells by targeting VEGF-C.
26543080 MTA1 Is Up-regulated in Colorectal Cancer and Is Inversely Correlated with Lymphatic Metastasis.
26467187 2016 Human lung-resident macrophages express CB1 and CB2 receptors whose activation inhibits the release of angiogenic and lymphangiogenic factors.
26460960 2015 MicroRNA-27b, microRNA-101 and microRNA-128 inhibit angiogenesis by down-regulating vascular endothelial growth factor C expression in gastric cancers.
26443563 2015 The significance of lymphatic space invasion and its association with vascular endothelial growth factor-C expression in ovarian cancer.
26339369 2015 Both high expression of pyruvate kinase M2 and vascular endothelial growth factor-C predicts poorer prognosis in human breast cancer.
26313304 2015 Comparing the Hem- and Lymphangiogenic Profile of Conjunctival and Uveal Melanoma Cell Lines.
More...