Property Summary

NCBI Gene PubMed Count 393
PubMed Score 1028.15
PubTator Score 780.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
aldosterone-producing adenoma -1.230 6.9e-03
cystic fibrosis 1.179 9.1e-06
ependymoma 1.600 8.0e-07
fibroadenoma -1.300 8.3e-03
gastric carcinoma 1.200 7.1e-03
intraductal papillary-mucinous adenoma (... -1.800 1.5e-03
intraductal papillary-mucinous carcinoma... -1.600 3.3e-03
intraductal papillary-mucinous neoplasm ... -1.800 1.6e-02
malignant mesothelioma -1.700 4.5e-07
osteosarcoma -1.994 4.0e-04
ovarian cancer -1.600 2.9e-05
pituitary cancer 1.600 3.2e-04
psoriasis -1.100 7.6e-06

 CSPA Cell Line (1)

Gene RIF (380)

AA Sequence

MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELM      1 - 70
TVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDV     71 - 140
GKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCR    141 - 210
CMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDIC    211 - 280
GPNKELDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRN    281 - 350
QPLNPGKCACECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS     351 - 419
//

Text Mined References (395)

PMID Year Title