Property Summary

Ligand Count 1
NCBI Gene PubMed Count 62
PubMed Score 236.99
PubTator Score 115.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ductal carcinoma in situ -1.200 1.3e-03
fibroadenoma -1.600 1.5e-02
glioblastoma 1.400 2.4e-05
invasive ductal carcinoma -1.200 1.3e-02
malignant mesothelioma 1.200 5.8e-06
psoriasis -1.100 1.2e-06

Protein-protein Interaction (4)

Gene RIF (45)

AA Sequence

MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVP      1 - 70
SCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT     71 - 140
PHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA       141 - 207
//

Text Mined References (62)

PMID Year Title