Property Summary

NCBI Gene PubMed Count 59
Grant Count 27
R01 Count 14
Funding $1,918,608.54
PubMed Score 216.31
PubTator Score 115.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis -1.100 0.000
glioblastoma 1.400 0.000
fibroadenoma -1.600 0.015
ductal carcinoma in situ -1.200 0.001
invasive ductal carcinoma -1.200 0.013

Gene RIF (43)

PMID Text
26422603 VEGFA and VEGFB associated sub-network, kinase insert domain receptor (KDR), fibronectin 1 (FN1), transforming growth factor beta induced (TGFBI) and proliferating cell nuclear antigen (PCNA) found to interact with at least two of the three hub genes.
25977072 plasma VEGF levels before treatment were lower in patients with schizophrenia and that their VEGF levels increased after treatment.
25633991 Frameshift mutations of VEGFB gene is associated with stomach and colorectal cancers.
25435370 fluid shear stress induces the synthesis of Insulin growth factor-2 and vascular endothelial growth factor (VEGF) B and D, which in turn transactivate MMP-12.
25424698 MMP9 may activate VEGF-B via PI3K/Akt signaling pathway.
25001655 High VEGF-B levels might correlate with the presence of hyperlipidemia and target organ damage in type 2 diabetic patients.
24987705 Roles of vascular endothelial growth factor in amyotrophic lateral sclerosis.
24987005 VEGF-B has possible roles in cardiac protection, energy metabolism support, and neuroprotectin [review]
24374930 Our study suggested that VEGF-B was an angiogenesis factor in vitro and that ERK1/2 and p38-related signaling pathways were involved in these VEGF-B activities.
24145997 Low VEGFB and VEGFD gene expression is associated with early-stage non-small cell lung cancer.
More...

AA Sequence

MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVP      1 - 70
SCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT     71 - 140
PHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA       141 - 207
//

Text Mined References (59)

PMID Year Title
26422603 2015 Bioinformatics Analyses of the Role of Vascular Endothelial Growth Factor in Patients with Non-Small Cell Lung Cancer.
25977072 2015 Alterations in plasma vascular endothelial growth factor levels in patients with schizophrenia before and after treatment.
25633991 2015 Frameshift mutation of an angiogenesis factor VEGFB and its mutational heterogeneity in colorectal cancers.
25435370 2015 Fluid shear promotes chondrosarcoma cell invasion by activating matrix metalloproteinase 12 via IGF-2 and VEGF signaling pathways.
25424698 2015 Vascular endothelial growth factor B coordinates metastasis of non-small cell lung cancer.
25001655 Clinical association of circulating VEGF-B levels with hyperlipidemia and target organ damage in type 2 diabetic patients.
24987705 2014 Roles of vascular endothelial growth factor in amyotrophic lateral sclerosis.
24987005 2014 Vascular endothelial growth factor-B in physiology and disease.
24374930 2014 Effects of vascular endothelial growth factor B on proliferation and migration in EA.Hy926 cells.
24145997 2014 A gene signature combining the tissue expression of three angiogenic factors is a prognostic marker in early-stage non-small cell lung cancer.
More...