Property Summary

Ligand Count 17
NCBI Gene PubMed Count 269
PubMed Score 3428.97
PubTator Score 1033.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Disease Target Count
Spontaneous abortion 113

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma 2.100 5.1e-03
Atopic dermatitis 1.100 3.0e-05
cutaneous lupus erythematosus 1.600 3.6e-03
cystic fibrosis 1.549 1.7e-05
ependymoma 2.300 3.5e-03
glioblastoma 1.100 1.7e-03
group 3 medulloblastoma 1.800 1.9e-04
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
malignant mesothelioma -2.700 9.8e-08
Multiple myeloma -1.473 2.2e-02
non-small cell lung cancer 1.656 2.6e-11
oligodendroglioma 2.300 1.2e-03
osteosarcoma 2.386 3.4e-08
ovarian cancer -1.100 1.1e-02
pancreatic ductal adenocarcinoma liver m... 2.214 3.2e-03
pediatric high grade glioma 1.100 4.8e-03
Pick disease 1.200 9.0e-08
primitive neuroectodermal tumor 1.300 3.6e-02

 GWAS Trait (1)

Gene RIF (240)

AA Sequence

MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVE      1 - 70
HMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPD     71 - 140
MPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMK    141 - 210
PERCGDAVPRR                                                               211 - 221
//

Text Mined References (269)

PMID Year Title