Property Summary

NCBI Gene PubMed Count 242
Grant Count 233
R01 Count 129
Funding $29,115,625.49
PubMed Score 3304.44
PubTator Score 1033.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession P49763 Q07101 Q9BV78 Q9Y6S8 PlGF
Symbols PGFL
PIGF
PLGF
PlGF-2
D12S1900
SHGC-10760

Gene

PGF

PANTHER Protein Class (2)

PDB

1RV6   1FZV  

Gene RIF (213)

PMID Text
27064391 Placental growth factor is a susceptibility gene for nAMD in a Chinese population, providing new evidence to support a biological role of PGF in choroidal neovascularization.
26930634 In patients with acute coronary syndrome, elevated plasma levels of PlGF are associated with the presence of obstructive sleep apnea and with adverse outcomes during short-term follow-up
26824454 PLGF enhances OVC cell invasion through MAPK-p38-dependent activation of ZEB2.
26785251 Results show that aqueous humor levels of VEGF-A and PlGF were significantly elevated in the eyes with neovascular glaucoma, and there was a positive correlation between the levels.
26775845 Our results demonstrated the pro-inflammatory and angiogenic effects of PlGF on HIMECs in IBD through activation of PI3K/Akt signaling pathway. PlGF/PI3K/Akt signaling may serve as a potential therapeutic target for IBD.
26699385 PLGF are higher in heart failure patients.
26642248 soluble fms-like tyrosine kinase-1 and placental growth factor as biomarkers in patients with coronary artery disease
26576922 concentration of these C-reactive protein, myeloperoxidase, soluble CD40 ligand and placental growth factor were significantly increased in acute coronary syndrome patients
26418253 Study found that PLGF and MMP9 levels both significantly increased in the non-small cell lung cancer (NSCLC) specimens and were strongly correlated. PLGF regulated MMP9 in NSCLC cells, but not vice versa.
26408539 PLGF is upregulated in vascular cells in response to fluid shear stress.
More...

AA Sequence

MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVE      1 - 70
HMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPD     71 - 140
MPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMK    141 - 210
PERCGDAVPRR                                                               211 - 221
//

Text Mined References (242)

PMID Year Title
27064391 2016 Identification of PGF as a New Gene for Neovascular Age-Related Macular Degeneration in a Chinese Population.
26930634 2016 Impact of Obstructive Sleep Apnea on the Levels of Placental Growth Factor (PlGF) and Their Value for Predicting Short-Term Adverse Outcomes in Patients with Acute Coronary Syndrome.
26824454 2016 Placental Growth Factor Promotes Ovarian Cancer Cell Invasion via ZEB2.
26785251 2016 Placenta Growth Factor in Eyes with Neovascular Glaucoma Is Decreased after Intravitreal Ranibizumab Injection.
26775845 2016 Placental growth factor enhances angiogenesis in human intestinal microvascular endothelial cells via PI3K/Akt pathway: Potential implications of inflammation bowel disease.
26699385 2016 Elevated Soluble Fms-Like Tyrosine Kinase-1 and Placental-Like Growth Factor Levels Are Associated With Development and Mortality Risk in Heart Failure.
26642248 2016 Prognostic use of soluble fms-like tyrosine kinase-1 and placental growth factor in patients with coronary artery disease.
26576922 2015 Systemic and coronary levels of CRP, MPO, sCD40L and PlGF in patients with coronary artery disease.
26418253 2015 Placental growth factor promotes metastases of non-small cell lung cancer through MMP9.
26408539 2015 Fluid shear stress upregulates placental growth factor in the vessel wall via NADPH oxidase 4.
More...