Property Summary

NCBI Gene PubMed Count 26
PubMed Score 28.43
PubTator Score 8.39

Knowledge Summary

Patent (2,501)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.342 0.000
ovarian cancer 1.100 0.000

Synonym

Accession P49761 D3DW59 Q53Y48 Q9BRS3 Q9BUJ7
Symbols PHCLK3
PHCLK3/152

Gene

PDB

2EU9   2EXE   2WU6   2WU7   3RAW  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2710 other 28 / 0 / 0 Kinase Inhibition Profile Study on Inhibitors of CDC-like Kinase 4
504428 confirmatory 25 / 0 / 40 Kinase Inhibition Study on Inhibitors of CDC-like Kinase 3 (Reaction Biology data)
624049 confirmatory 9 / 0 / 24 Reaction Biology data for inhibitors of CLK3: Probe SAR

Gene RIF (2)

PMID Text
19426592 regulated but the expression of CDK9, CDC20 and CLK3 was down- regulated in azoospermic testes.
19168442 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.

AA Sequence

MPVLSARRRELADHAGSGRRSGPSPTARSGPHLSALRAQPARAAHLSGRGTYVRRDTAGGGPGQARPLGP      1 - 70
PGTSLLGRGARRSGEGWCPGAFESGARAARPPSRVEPRLATAASREGAGLPRAEVAAGSGRGARSGEWGL     71 - 140
AAAGAWETMHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRLPYQRRYR    141 - 210
ERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRS    211 - 280
SRSVEDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEI    281 - 350
NVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALR    351 - 420
FLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRP    421 - 490
PEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGL    491 - 560
VWDENSSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERSF    561 - 630
HTSRNPSR                                                                  631 - 638
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25281661 2015 Genome-wide association study identified SNP on 15q24 associated with bladder cancer risk in Japanese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21615147 2011 Leucettines, a class of potent inhibitors of cdc2-like kinases and dual specificity, tyrosine phosphorylation regulated kinases derived from the marine sponge leucettamine B: modulation of alternative pre-RNA splicing.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...