Property Summary

Ligand Count 1
NCBI Gene PubMed Count 26
PubMed Score 28.52
PubTator Score 8.39

Knowledge Summary

Patent (2,501)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.2e-07
osteosarcoma 7950 1.2e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.342 1.2e-07
ovarian cancer 1.100 1.2e-07

Pathway (1)

Gene RIF (2)

AA Sequence

MPVLSARRRELADHAGSGRRSGPSPTARSGPHLSALRAQPARAAHLSGRGTYVRRDTAGGGPGQARPLGP      1 - 70
PGTSLLGRGARRSGEGWCPGAFESGARAARPPSRVEPRLATAASREGAGLPRAEVAAGSGRGARSGEWGL     71 - 140
AAAGAWETMHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRLPYQRRYR    141 - 210
ERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRS    211 - 280
SRSVEDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEI    281 - 350
NVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALR    351 - 420
FLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRP    421 - 490
PEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGL    491 - 560
VWDENSSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERSF    561 - 630
HTSRNPSR                                                                  631 - 638
//

Text Mined References (35)

PMID Year Title