Property Summary

Ligand Count 9
NCBI Gene PubMed Count 32
PubMed Score 1.27
PubTator Score 19.50

Knowledge Summary

Patent (5,126)

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.100 5.5e-03
group 3 medulloblastoma 1.400 4.6e-04
lung cancer 1.300 7.3e-04
ovarian cancer -1.300 2.1e-07

Gene RIF (7)

AA Sequence

MPHPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDRRVYD      1 - 70
RRYCGSYRRNDYSRDRGDAYYDTDYRHSYEYQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSQHSSRRA     71 - 140
KSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEIN    141 - 210
VLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKF    211 - 280
LHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAP    281 - 350
EVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLD    351 - 420
WDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFARLRAEPPNKL    421 - 490
WDSSRDISR                                                                 491 - 499
//

Text Mined References (37)

PMID Year Title