Property Summary

NCBI Gene PubMed Count 30
Grant Count 15
R01 Count 12
Funding $618,544.04
PubMed Score 1.10
PubTator Score 19.50

Knowledge Summary

Patent (5,126)

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.100 0.005
lung cancer 1.300 0.001
group 3 medulloblastoma 1.400 0.000
ovarian cancer -1.300 0.000

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2710 other 28 / 0 / 0 Kinase Inhibition Profile Study on Inhibitors of CDC-like Kinase 4
504427 confirmatory 59 / 0 / 6 Kinase Inhibition Study on Inhibitors of CDC-like Kinase 2 (Reaction Biology data)
624048 confirmatory 26 / 1 / 6 Reaction Biology data for inhibitors of CLK2: Probe SAR

Gene RIF (6)

PMID Text
27126587 Clk1, Clk2 and Clk4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
25670169 Loss of CLK2 in luminal breast cancer cells leads to the upregulation of epithelial-to-mesenchymal transition (EMT)-related genes and a switch to mesenchymal splice variants of several genes.
23376537 LAMMER/Cdc2-like kinase, represented by Doa and its mammalian homolog CLK2, is a critical and conserved component in the regulatory program of the mitosis-to-meiosis switch
21682887 CLK1 Increases While CLK2 Decreases HIV-1 Gene Expression.
20682768 AKT activation controls cell survival to ionizing radiation by phosphorylating CLK2, revealing an important regulatory mechanism required for promoting cell survival.
19168442 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.

AA Sequence

MPHPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDRRVYD      1 - 70
RRYCGSYRRNDYSRDRGDAYYDTDYRHSYEYQRENSSYRSQRSSRRKHRRRRRRSRTFSRSSSQHSSRRA     71 - 140
KSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEIN    141 - 210
VLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKF    211 - 280
LHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAP    281 - 350
EVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLD    351 - 420
WDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFARLRAEPPNKL    421 - 490
WDSSRDISR                                                                 491 - 499
//

Text Mined References (35)

PMID Year Title
27126587 2016 Clks 1, 2 and 4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
25670169 2015 CLK2 Is an Oncogenic Kinase and Splicing Regulator in Breast Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23376537 2013 The highly conserved LAMMER/CLK2 protein kinases prevent germ cell overproliferation in Drosophila.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21682887 2011 Differential effect of CLK SR Kinases on HIV-1 gene expression: potential novel targets for therapy.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20682768 2010 Phosphorylation of CLK2 at serine 34 and threonine 127 by AKT controls cell survival after ionizing radiation.
More...