Property Summary

NCBI Gene PubMed Count 30
PubMed Score 79.63
PubTator Score 61.52

Knowledge Summary

Patent (25,929)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 7.27075053019119E-11
juvenile dermatomyositis 1189 2.73189057115171E-8
acute quadriplegic myopathy 1157 4.18509038026934E-5
osteosarcoma 7933 2.33233334803666E-4
Pick disease 1893 3.97836771734444E-4
lung cancer 4473 9.39456123553844E-4
dermatomyositis 967 0.00126355129894597
glioblastoma 5572 0.00686121484535759
ependymoma 2514 0.00767401299704756
Multiple myeloma 1328 0.0160838191130449
acute myeloid leukemia 785 0.0174483898773713
astrocytic glioma 2241 0.0273783816680906
progressive supranuclear palsy 674 0.0412097239927271

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.292 0.016
astrocytic glioma 1.400 0.027
ependymoma 1.800 0.008
osteosarcoma -1.176 0.000
glioblastoma 1.100 0.007
juvenile dermatomyositis 1.079 0.000
acute quadriplegic myopathy 1.133 0.000
non-small cell lung cancer -1.205 0.000
lung cancer -1.300 0.001
Pick disease -1.700 0.000
progressive supranuclear palsy -1.500 0.041
acute myeloid leukemia 1.800 0.017
ovarian cancer -3.000 0.000
dermatomyositis 1.300 0.001

Synonym

Accession P49759 B4DFW7 Q0P694 Q8N5V8
Symbols CLK
STY
CLK/STY

Gene

PDB

1Z57   2VAG   5J1V   5J1W  

  Ortholog (12)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 MGI Term (1)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2710 other 28 / 0 / 0 Kinase Inhibition Profile Study on Inhibitors of CDC-like Kinase 4
488887 summary 29 / 0 / 0 qHTS for Inhibitors of CDC-like Kinase 1 and 4: Summary
504430 confirmatory 60 / 0 / 5 Kinase Inhibition Study on Inhibitors of CDC-like Kinase 1 (Reaction Biology data)
588811 confirmatory 158 / 2 / 37 MLPCN Dyrk1A - CLK1 Selectivity Assay Measured in Biochemical System Using Plate Reader - 2124-05_Inhibitor_Dose_CherryPick_Activity
624047 confirmatory 30 / 0 / 3 Reaction Biology data for inhibitors of CLK1: Probe SAR

Gene RIF (11)

PMID Text
27126587 Clk1, Clk2 and Clk4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
26443864 removal of the N-terminus or dilution of CLK1 induces monomer formation and reverses this specificity. CLK1 self-association also occurs in the nucleus
25961505 Nuclear CLK-1 mediates a retrograde signalling pathway that is conserved from Caenorhabditis elegans to humans and is responsive to mitochondrial reactive oxygen species, thus acting as a barometer of oxidative metabolism.
25529026 Data suggest that proline phosphorylation by CLK1/CDC-like kinase 1 (but not by SRPK1/serine/arginine-rich splicing factor kinase 1) regulates conformation and alternative splicing function of SFRS1 (serine/arginine-rich splicing factor 1).
24869919 findings suggest that CLK1-dependent hyperphosphorylation is the result of a general mechanism in which the N-terminus acts as a bridge connecting the kinase domain and the RS domain of the SR protein.
23707382 The data establish a new view of SRSF1 protein regulation in which SRPK1 and CLK1 partition activities based on Ser-Pro versus Arg-Ser placement rather than on N- and C-terminal preferences along the RS domain.
21682887 CLK1 Increases While CLK2 Decreases HIV-1 Gene Expression.
19168442 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.
18814951 five genes (TNFSF10/TRAIL, IL1RN, IFI27, GZMB, and CCR5) were upregulated and three genes (CLK1, TNFAIP3 and BTG1) were downregulated in at least three out of four subpopulations during acute GVHD.
16223727 ASF/SF2 is phosphorylated by SRPK1 and Clk/Sty
More...

AA Sequence

MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESRSINEKDYHSR      1 - 70
RYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIHHSTSHRRSHGKSHRRKRTRS     71 - 140
VEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDRYCEAARSEIQVL    141 - 210
EHLNTTDPNSTFRCVQMLEWFEHHGHICIVFELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLH    211 - 280
SNKLTHTDLKPENILFVQSDYTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEV    281 - 350
ILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD    351 - 420
EHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLLKKSI          421 - 484
//

Text Mined References (38)

PMID Year Title
27126587 2016 Clks 1, 2 and 4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
26443864 2015 Nuclear protein kinase CLK1 uses a non-traditional docking mechanism to select physiological substrates.
25961505 2015 A nuclear role for the respiratory enzyme CLK-1 in regulating mitochondrial stress responses and longevity.
25529026 2015 Conserved proline-directed phosphorylation regulates SR protein conformation and splicing function.
25416956 2014 A proteome-scale map of the human interactome network.
24869919 2014 N-terminus of the protein kinase CLK1 induces SR protein hyperphosphorylation.
23707382 2013 Partitioning RS domain phosphorylation in an SR protein through the CLK and SRPK protein kinases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21682887 2011 Differential effect of CLK SR Kinases on HIV-1 gene expression: potential novel targets for therapy.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...