Property Summary

Ligand Count 48
NCBI Gene PubMed Count 34
PubMed Score 87.90
PubTator Score 61.52

Knowledge Summary

Patent (25,929)

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.800 1.7e-02
acute quadriplegic myopathy 1.133 4.2e-05
astrocytic glioma 1.400 2.7e-02
dermatomyositis 1.300 1.3e-03
ependymoma 1.800 7.7e-03
glioblastoma 1.100 6.9e-03
juvenile dermatomyositis 1.079 2.7e-08
lung cancer -1.300 9.4e-04
Multiple myeloma 1.292 1.6e-02
non-small cell lung cancer -1.205 1.5e-15
osteosarcoma -1.176 2.3e-04
ovarian cancer -3.000 7.3e-11
Pick disease -1.700 4.0e-04
progressive supranuclear palsy -1.500 4.1e-02

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (15)

AA Sequence

MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESRSINEKDYHSR      1 - 70
RYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIHHSTSHRRSHGKSHRRKRTRS     71 - 140
VEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDRYCEAARSEIQVL    141 - 210
EHLNTTDPNSTFRCVQMLEWFEHHGHICIVFELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLH    211 - 280
SNKLTHTDLKPENILFVQSDYTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEV    281 - 350
ILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD    351 - 420
EHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLLKKSI          421 - 484
//

Text Mined References (42)

PMID Year Title