Property Summary

NCBI Gene PubMed Count 30
Grant Count 64
R01 Count 42
Funding $5,752,304.58
PubMed Score 79.63
PubTator Score 61.52

Knowledge Summary

Patent (25,929)

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.292 0.016
astrocytic glioma 1.400 0.027
ependymoma 1.800 0.008
osteosarcoma -1.176 0.000
glioblastoma 1.100 0.007
juvenile dermatomyositis 1.079 0.000
acute quadriplegic myopathy 1.133 0.000
non-small cell lung cancer -1.205 0.000
lung cancer -1.300 0.001
Pick disease -1.700 0.000
progressive supranuclear palsy -1.500 0.041
acute myeloid leukemia 1.800 0.017
ovarian cancer -3.000 0.000
dermatomyositis 1.300 0.001

Synonym

Accession P49759 B4DFW7 Q0P694 Q8N5V8
Symbols CLK
STY
CLK/STY

Gene

PDB

1Z57   2VAG   5J1V   5J1W  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2710 other 28 / 0 / 0 Kinase Inhibition Profile Study on Inhibitors of CDC-like Kinase 4
488887 summary 29 / 0 / 0 qHTS for Inhibitors of CDC-like Kinase 1 and 4: Summary
504430 confirmatory 60 / 0 / 5 Kinase Inhibition Study on Inhibitors of CDC-like Kinase 1 (Reaction Biology data)
588811 confirmatory 158 / 2 / 37 MLPCN Dyrk1A - CLK1 Selectivity Assay Measured in Biochemical System Using Plate Reader - 2124-05_Inhibitor_Dose_CherryPick_Activity
624047 confirmatory 30 / 0 / 3 Reaction Biology data for inhibitors of CLK1: Probe SAR

Gene RIF (11)

PMID Text
27126587 Clk1, Clk2 and Clk4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
26443864 removal of the N-terminus or dilution of CLK1 induces monomer formation and reverses this specificity. CLK1 self-association also occurs in the nucleus
25961505 Nuclear CLK-1 mediates a retrograde signalling pathway that is conserved from Caenorhabditis elegans to humans and is responsive to mitochondrial reactive oxygen species, thus acting as a barometer of oxidative metabolism.
25529026 Data suggest that proline phosphorylation by CLK1/CDC-like kinase 1 (but not by SRPK1/serine/arginine-rich splicing factor kinase 1) regulates conformation and alternative splicing function of SFRS1 (serine/arginine-rich splicing factor 1).
24869919 findings suggest that CLK1-dependent hyperphosphorylation is the result of a general mechanism in which the N-terminus acts as a bridge connecting the kinase domain and the RS domain of the SR protein.
23707382 The data establish a new view of SRSF1 protein regulation in which SRPK1 and CLK1 partition activities based on Ser-Pro versus Arg-Ser placement rather than on N- and C-terminal preferences along the RS domain.
21682887 CLK1 Increases While CLK2 Decreases HIV-1 Gene Expression.
19168442 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.
18814951 five genes (TNFSF10/TRAIL, IL1RN, IFI27, GZMB, and CCR5) were upregulated and three genes (CLK1, TNFAIP3 and BTG1) were downregulated in at least three out of four subpopulations during acute GVHD.
16223727 ASF/SF2 is phosphorylated by SRPK1 and Clk/Sty
More...

AA Sequence

MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESRSINEKDYHSR      1 - 70
RYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIHHSTSHRRSHGKSHRRKRTRS     71 - 140
VEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDRYCEAARSEIQVL    141 - 210
EHLNTTDPNSTFRCVQMLEWFEHHGHICIVFELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLH    211 - 280
SNKLTHTDLKPENILFVQSDYTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEV    281 - 350
ILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD    351 - 420
EHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLLKKSI          421 - 484
//

Text Mined References (38)

PMID Year Title
27126587 2016 Clks 1, 2 and 4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
26443864 2015 Nuclear protein kinase CLK1 uses a non-traditional docking mechanism to select physiological substrates.
25961505 2015 A nuclear role for the respiratory enzyme CLK-1 in regulating mitochondrial stress responses and longevity.
25529026 2015 Conserved proline-directed phosphorylation regulates SR protein conformation and splicing function.
25416956 2014 A proteome-scale map of the human interactome network.
24869919 2014 N-terminus of the protein kinase CLK1 induces SR protein hyperphosphorylation.
23707382 2013 Partitioning RS domain phosphorylation in an SR protein through the CLK and SRPK protein kinases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21682887 2011 Differential effect of CLK SR Kinases on HIV-1 gene expression: potential novel targets for therapy.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...