Property Summary

NCBI Gene PubMed Count 45
PubMed Score 31.19
PubTator Score 21.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.100 9.9e-26
adult high grade glioma -1.800 4.1e-05
Astrocytoma, Pilocytic -1.300 1.7e-04
atypical teratoid / rhabdoid tumor -1.400 6.0e-05
ependymoma -1.500 4.7e-11
glioblastoma -1.200 4.3e-04
group 4 medulloblastoma -1.300 2.7e-03
medulloblastoma, large-cell -1.900 4.2e-04
primitive neuroectodermal tumor -1.200 6.3e-03

Protein-protein Interaction (2)

Gene RIF (24)

AA Sequence

MAQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLM      1 - 70
KNLSIEDPVEAIHLGSLIAAQGYIFPISDHVLTMKDDGTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTM     71 - 140
QNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCV    141 - 210
NTTEMDIRKCRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMS    211 - 280
KVAESLIAYTEQYVEYDPLITPAEPSNPWISDDVALWDIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQF    281 - 350
LRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRY    351 - 420
TFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKGKSLAGKRLTGLMQSS                      421 - 472
//

Text Mined References (47)

PMID Year Title