Property Summary

NCBI Gene PubMed Count 42
Grant Count 34
R01 Count 29
Funding $3,582,054.72
PubMed Score 29.80
PubTator Score 21.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group A ependymoma -1.700 0.000
glioblastoma -1.600 0.000
group 4 medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.300 0.007
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -1.300 0.000
psoriasis -1.100 0.000

Gene RIF (20)

PMID Text
26653562 reduced RGS6 expression is associated with poor survival in colorectal cancer patients, suggesting that RGS6 expression may serve as an important prognostic marker
26340433 No significant association between SNPs of RGS6 and central adiposity has been found.
25525169 we found a novel mutation in RGS6, the splice-acceptor variant c.1369-1G>C that was not previously reported in congenital cataract phenotypes.
25120791 these date demonstrate that RGS6 decreases in tumor tissue and may serve as a novel biomarker for outcomes in pancreatic cancer patients and be a potential therapeutic target potential therapeutic target.
23619123 This suggests that HA117 might be an important resistance gene in pediatric solid tumors.
21233807 genetic association studies in Hispanic-American families in Texas and Colorado: SNP in RGS6 are associated with high dietary fat intake, food preferences, and adiposity/obesity phenotype
21041304 RGS6-induced apoptosis in both breast cancer cells and mouse embryonic fibroblasts does not require its GAP activity toward G proteins
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLM      1 - 70
KNLSIEDPVEAIHLGSLIAAQGYIFPISDHVLTMKDDGTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTM     71 - 140
QNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCV    141 - 210
NTTEMDIRKCRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMS    211 - 280
KVAESLIAYTEQYVEYDPLITPAEPSNPWISDDVALWDIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQF    281 - 350
LRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRY    351 - 420
TFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKGKSLAGKRLTGLMQSS                      421 - 472
//

Text Mined References (44)

PMID Year Title
26653562 2015 Prognostic value of regulator of G-protein signaling 6 in colorectal cancer.
26340433 2015 A Common Variant of NGEF Is Associated with Abdominal Visceral Fat in Korean Men.
26097584 2015 Differential expression of FOXA1, DUSP6, and HA117 in colon segments of Hirschsprung's disease.
25525169 2014 RGS6: a novel gene associated with congenital cataract, mental retardation, and microcephaly in a Tunisian family.
25120791 2014 Decreased RGS6 expression is associated with poor prognosis in pancreatic cancer patients.
25120773 2014 Expression profiles of HA117 and its neighboring gene DPF3 in different colon segments of Hirschsprung's disease.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23619123 2014 Expression of the novel all-trans retinoic acid-related resistance gene HA117 in pediatric solid tumors.
More...