Property Summary

NCBI Gene PubMed Count 97
PubMed Score 402.12
PubTator Score 279.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.100 1.2e-02
astrocytic glioma 1.100 2.0e-02
ependymoma 1.300 4.3e-03
glioblastoma -1.600 1.1e-04
intraductal papillary-mucinous adenoma (... 1.700 1.9e-04
intraductal papillary-mucinous carcinoma... 1.600 5.9e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.6e-02
medulloblastoma, large-cell -1.200 8.4e-03
oligodendroglioma 1.300 2.7e-03
osteosarcoma -2.546 5.9e-07
ovarian cancer -2.100 3.4e-17
Pick disease 1.400 5.5e-04
psoriasis -1.800 1.8e-04
Rheumatoid arthritis 1.600 5.3e-03
tuberculosis and treatment for 6 months -1.200 1.9e-04

Protein-protein Interaction (5)

Gene RIF (65)

AA Sequence

MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERK      1 - 70
FFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWI     71 - 140
CHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIM    141 - 210
KQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGF    211 - 280
PALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPM    281 - 350
TKPVTVVAPQSPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS    351 - 420
SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTS    421 - 490
QPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQ    491 - 560
TFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQR    561 - 630
TNPSPTNPFSSDLQKTFEIEL                                                     631 - 651
//

Text Mined References (105)

PMID Year Title