Property Summary

NCBI Gene PubMed Count 81
Grant Count 145
R01 Count 101
Funding $16,776,489.06
PubMed Score 374.05
PubTator Score 279.66

Knowledge Summary

Patent

No data available

Expression

Gene

PANTHER Protein Class (1)

Gene RIF (51)

PMID Text
26944313 Dominant negative NUMB expression confers a high proliferative phenotype to chronic myeloid leukemia cells.
26415596 Numb polymorphisms are associated with coronary artery disease among Han Chinese and Uighur Chinese in Xinjiang, China.
26307032 Notch1/Numb/Snail signal pathway plays an important role in the pathogenesis of adenomyosis.
26264115 results indicated that both rs2108552 and rs17781919 in the Numb gene were associated with total cholesterol level and density lipoprotein-cholesterol level in Chinese subjects.
26261495 Alternative splicing of APP, VEGFA and NUMB may play an important role in pathogenesis of pancreatic ductal adenocarcinoma.
26174965 NANOG-NUMB-p53 signaling axis is an important regulatory pathway for tumor-initiating cells events in TIC self-renewal and liver tumorigenesis
26165304 Methylation of the Numb promoter contributed to hepatocarcinogenesis.
26074693 Report alternative splicing of NUMB in colorectal cancer.
26069237 Numb/Numbl control VEGF receptor endocytosis, signaling, and recycling in endothelial cells, which promotes the angiogenic growth of blood vessels.
26058814 Alternative splicing of Numb may provide a useful prognostic biomarker in HCC and is pharmacologically tractable
More...

AA Sequence

MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERK      1 - 70
FFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWI     71 - 140
CHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIM    141 - 210
KQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGF    211 - 280
PALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPM    281 - 350
TKPVTVVAPQSPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS    351 - 420
SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTS    421 - 490
QPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQ    491 - 560
TFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQR    561 - 630
TNPSPTNPFSSDLQKTFEIEL                                                     631 - 651
//

Text Mined References (89)

PMID Year Title
26944313 2016 NUMB inactivation confers resistance to imatinib in chronic myeloid leukemia cells.
26415596 2015 The association of cholesterol absorption gene Numb polymorphism with Coronary Artery Disease among Han Chinese and Uighur Chinese in Xinjiang, China.
26307032 2015 Aberrant expression of Notch1/numb/snail signaling, an epithelial mesenchymal transition related pathway, in adenomyosis.
26264115 2015 Genetic variants of numb gene were associated with elevated total cholesterol level and low density lipoprotein cholesterol level in Chinese subjects, in Xinjiang, China.
26261495 2015 Alternative splicing of NUMB, APP and VEGFA as the features of pancreatic ductal carcinoma.
26174965 2015 NUMB phosphorylation destabilizes p53 and promotes self-renewal of tumor-initiating cells by a NANOG-dependent mechanism in liver cancer.
26165304 2015 Numb downregulation suppresses cell growth and is associated with a poor prognosis of human hepatocellular carcinoma.
26074693 2015 Alternative splicing of VEGFA, APP and NUMB genes in colorectal cancer.
26069237 2015 Regulation of vascular endothelial growth factor receptor function in angiogenesis by numb and numb-like.
26058814 2015 Alternative splicing of the cell fate determinant Numb in hepatocellular carcinoma.
More...