Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
R01 Count 5
Funding $496,525.25
PubMed Score 15.94
PubTator Score 48.52

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P49756 A0PJL9 B2RNA8 B3KT03 Q2TA72 Q5XJ17 Q6P665 Q9H6A1 Q9UEQ5 Q9UIE9
Symbols S164
NET52
RNPC7
Snu71
RED120
fSAP94

Gene

PDB

3V53  

Gene RIF (5)

PMID Text
23190262 Structure-guided mutagenesis reveals a positively charged nucleic-acid-binding surface in the RBM25 PWI domain
21859973 RBM25/LUC7L3-mediated abnormal SCN5A mRNA splicing reduced Na+ channel current 91.1+/-9.3% to a range known to cause sudden death.
18854154 Knockdown of RNA binding motif protein 25 (RBM25) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18663000 These data suggest a novel mode for Bcl-x(S) 5' ss activation in which binding of RBM25 with exonic element CGGGCA may stabilize the pre-mRNA-U1 snRNP through interactions with hLuc7A.
17560998 RED120 may function to couple splicing with mRNA 3'-end formation.

AA Sequence

MSFPPHLNRPPMGIPALPPGIPPPQFPGFPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKD      1 - 70
HPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQGASGKLQAFGFCEYKEPEST     71 - 140
LRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKASNGNARPETVTNDDEEALDEETKRRDQMIKGA    141 - 210
IEVLIREYSSELNAPSQESDSHPRKKKKEKKEDIFRRFPVAPLIPYPLITKEDINAIEMEEDKRDLISRE    211 - 280
ISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRD    281 - 350
RDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERE    351 - 420
REREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMA    421 - 490
KEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHPDPDA    491 - 560
ELQRMEQEAERRRQPQIKQEPESEEEEEEKQEKEEKREEPMEEEEEPEQKPCLKPTLRPISSAPSVSSAS    561 - 630
GNATPNTPGDESPCGIIIPHENSPDQQQPEEHRPKIGLSLKLGASNSPGQPNSVKRKKLPVDSVFNKFED    631 - 700
EDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERR    701 - 770
IRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIG    771 - 840
LVK                                                                       841 - 843
//

Text Mined References (29)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23190262 2013 Crystal structure and functional characterization of the human RBM25 PWI domain and its flanking basic region.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21859973 2011 Role of RBM25/LUC7L3 in abnormal cardiac sodium channel splicing regulation in human heart failure.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...