Property Summary

NCBI Gene PubMed Count 39
PubMed Score 31.94
PubTator Score 38.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 1.6e-09
Breast cancer 2.700 4.0e-02
ependymoma 1.400 2.2e-17
glioblastoma 1.600 1.3e-03
Multiple myeloma 1.079 4.6e-03
osteosarcoma 1.085 5.5e-03
ovarian cancer -2.400 4.4e-10
pancreatic ductal adenocarcinoma liver m... -1.484 2.6e-02
pediatric high grade glioma 1.100 8.2e-06

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (20)

AA Sequence

MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGL      1 - 70
RSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAK     71 - 140
VEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRR    141 - 210
FFKAKKLIE                                                                 211 - 219
//

Text Mined References (52)

PMID Year Title