Property Summary

NCBI Gene PubMed Count 37
Grant Count 120
R01 Count 97
Funding $7,861,119.57
PubMed Score 31.41
PubTator Score 38.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.079 0.005
osteosarcoma 1.085 0.006
ependymoma 1.400 0.000
glioblastoma 1.600 0.001
pancreatic ductal adenocarcinoma liver m... -1.484 0.026
Breast cancer 2.700 0.040
pediatric high grade glioma 1.100 0.000
pilocytic astrocytoma 1.300 0.000
ovarian cancer -2.400 0.000

Synonym

Accession P49755 B2R605 Q15602 Q16536 Q86TC2 Q86TS5
Symbols p23
TMP21
p24d1
S31I125
Tmp-21-I
S31III125
P24(DELTA)

Gene

 GO Function (1)

 GWAS Trait (1)

Gene RIF (17)

PMID Text
26617795 TMP21 modulates cell growth in papillary thyroid cancer cells by inducing autophagy, which may be associated with activation of AMPK/mTOR pathway.
23434013 Study demonstrates that NleF binds to the human Tmp21 protein and subsequently disrupts intracellular protein trafficking.
23166591 Expression of HIV-1 Tat downregulates the abundance of transmembrane emp24-like trafficking protein 10 (TMED10) in the nucleoli of Jurkat T-cells
22299712 This study suggested that The role ofTMP21 in the modulation of gamma-secretase activity and protein trafficking and related to alzheimer disease.
22204304 Data show that the level of p23 expression is critical for neuronal function, and p23 overexpression initiates a cascade in brainstem that leads to severe motor deficits and other neurological problems, culminating in premature death.
22190034 Expression of HIV-1 Tat downregulates the abundance of transmembrane emp24-like trafficking protein 10 (TMED10) in the nucleoli of Jurkat T-cells
21699748 Results suggest that Tmp21 is a novel protein that preferentially binds to Beta(2)-microglobulin-free MHC-I heavy chains.
21454541 p23 acts as an anchoring protein that retains PKCdelta at the perinuclear region, thus limiting the availability of this kinase for activation in response to stimuli.
21219331 Transmembrane protein 23 and p24A differentially control G-protein coupled receptor trafficking and signaling in astrocytes.
20546612 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGL      1 - 70
RSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAK     71 - 140
VEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRR    141 - 210
FFKAKKLIE                                                                 211 - 219
//

Text Mined References (50)

PMID Year Title
26617795 2015 TMP21 modulates cell growth in papillary thyroid cancer cells by inducing autophagy through activation of the AMPK/mTOR pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23434013 2013 The enterohemorrhagic Escherichia coli effector protein NleF binds mammalian Tmp21.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22299712 2012 The role of TMP21 in trafficking and amyloid-? precursor protein (APP) processing in Alzheimer's disease.
22204304 2011 Transgenic neuronal overexpression reveals that stringently regulated p23 expression is critical for coordinated movement in mice.
21699748 2011 Tmp21, a novel MHC-I interacting protein, preferentially binds to ?2-microglobulin-free MHC-I heavy chains.
21545355 2011 Syntaxin 17 cycles between the ER and ERGIC and is required to maintain the architecture of ERGIC and Golgi.
21454541 2011 p23/Tmp21 associates with protein kinase Cdelta (PKCdelta) and modulates its apoptotic function.
More...