Property Summary

NCBI Gene PubMed Count 24
PubMed Score 14.39
PubTator Score 23.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.000 2.0e-02
ependymoma -1.900 2.7e-02
glioblastoma -1.300 2.2e-04
hepatocellular carcinoma 1.100 1.8e-04
medulloblastoma, large-cell -1.100 2.7e-04
Multiple myeloma 1.051 3.5e-03
oligodendroglioma -1.500 2.9e-02
osteosarcoma -1.196 3.4e-02
ovarian cancer -1.500 4.4e-07
Waldenstrons macroglobulinemia 1.082 4.8e-03

Gene RIF (7)

AA Sequence

MAEAEEQETGSLEESTDESEEEESEEEPKLKYERLSNGVTEILQKDAASCMTVHDKFLALGTHYGKVYLL      1 - 70
DVQGNITQKFDVSPVKINQISLDESGEHMGVCSEDGKVQVFGLYSGEEFHETFDCPIKIIAVHPHFVRSS     71 - 140
CKQFVTGGKKLLLFERSWMNRWKSAVLHEGEGNIRSVKWRGHLIAWANNMGVKIFDIISKQRITNVPRDD    141 - 210
ISLRPDMYPCSLCWKDNVTLIIGWGTSVKVCSVKERHASEMRDLPSRYVEIVSQFETEFYISGLAPLCDQ    211 - 280
LVVLSYVKEISEKTEREYCARPRLDIIQPLSETCEEISSDALTVRGFQENECRDYHLEYSEGESLFYIVS    281 - 350
PRDVVVAKERDQDDHIDWLLEKKKYEEALMAAEISQKNIKRHKILDIGLAYINHLVERGDYDIAARKCQK    351 - 420
ILGKNAALWEYEVYKFKEIGQLKAISPYLPRGDPVLKPLIYEMILHEFLESDYEGFATLIREWPGDLYNN    421 - 490
SVIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQLIHKHNLFSSIKDKIVLLM    491 - 560
DFDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHKLFKRDHHKGQRYHEKQISLYAEYDRPNLLP    561 - 630
FLRDSTHCPLEKALEICQQRNFVEETVYLLSRMGNSRSALKMIMEELHDVDKAIEFAKEQDDGELWEDLI    631 - 700
LYSIDKPPFITGLLNNIGTHVDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLS    701 - 770
LLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSA    771 - 840
KNRGPGSAILEMKK                                                            841 - 854
//

Text Mined References (28)

PMID Year Title