Property Summary

NCBI Gene PubMed Count 23
Grant Count 16
R01 Count 4
Funding $1,306,340.89
PubMed Score 12.39
PubTator Score 23.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
Waldenstrons macroglobulinemia 1.082 0.005
Multiple myeloma 1.051 0.003
astrocytic glioma -2.000 0.020
ependymoma -1.900 0.027
oligodendroglioma -1.500 0.029
osteosarcoma -1.196 0.034
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.600 0.005
ovarian cancer -1.500 0.000

Gene RIF (6)

PMID Text
25445562 VPS41 subunit of HOPS complex was defined to be the major partner for interacting with RILP.
23322049 hVps41 and VAMP7 are specifically involved in the fusion of trans-Golgi network-derived lysosome-associated membrane protein carriers with late endosomes.
23167963 Vps41 knockdown impairs late endosome fusion and fusion between late endosomes and lysosomes.
22323726 Both a functional heterotetrameric adaptor protein complex and a homotypic fusion and vacuole protein sorting-tethering complex are required for VPS41 to elicit neuroprotection in a transgenic model of Parkinson's disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19850127 These data show that hVPS41 is protective against both alpha-syn and neurotoxic-mediated injury in invertebrate and cellular models of PD.

AA Sequence

MAEAEEQETGSLEESTDESEEEESEEEPKLKYERLSNGVTEILQKDAASCMTVHDKFLALGTHYGKVYLL      1 - 70
DVQGNITQKFDVSPVKINQISLDESGEHMGVCSEDGKVQVFGLYSGEEFHETFDCPIKIIAVHPHFVRSS     71 - 140
CKQFVTGGKKLLLFERSWMNRWKSAVLHEGEGNIRSVKWRGHLIAWANNMGVKIFDIISKQRITNVPRDD    141 - 210
ISLRPDMYPCSLCWKDNVTLIIGWGTSVKVCSVKERHASEMRDLPSRYVEIVSQFETEFYISGLAPLCDQ    211 - 280
LVVLSYVKEISEKTEREYCARPRLDIIQPLSETCEEISSDALTVRGFQENECRDYHLEYSEGESLFYIVS    281 - 350
PRDVVVAKERDQDDHIDWLLEKKKYEEALMAAEISQKNIKRHKILDIGLAYINHLVERGDYDIAARKCQK    351 - 420
ILGKNAALWEYEVYKFKEIGQLKAISPYLPRGDPVLKPLIYEMILHEFLESDYEGFATLIREWPGDLYNN    421 - 490
SVIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQLIHKHNLFSSIKDKIVLLM    491 - 560
DFDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHKLFKRDHHKGQRYHEKQISLYAEYDRPNLLP    561 - 630
FLRDSTHCPLEKALEICQQRNFVEETVYLLSRMGNSRSALKMIMEELHDVDKAIEFAKEQDDGELWEDLI    631 - 700
LYSIDKPPFITGLLNNIGTHVDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLS    701 - 770
LLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSA    771 - 840
KNRGPGSAILEMKK                                                            841 - 854
//

Text Mined References (27)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26463206 2015 Characterization of the Mammalian CORVET and HOPS Complexes and Their Modular Restructuring for Endosome Specificity.
25908847 2015 The small GTPase Arl8b regulates assembly of the mammalian HOPS complex on lysosomes.
25783203 2015 Recruitment of VPS33A to HOPS by VPS16 Is Required for Lysosome Fusion with Endosomes and Autophagosomes.
25445562 2014 RILP interacts with HOPS complex via VPS41 subunit to regulate endocytic trafficking.
24210660 2013 Self-assembly of VPS41 promotes sorting required for biogenesis of the regulated secretory pathway.
23918659 2013 Vps33b pathogenic mutations preferentially affect VIPAS39/SPE-39-positive endosomes.
23901104 2013 Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
23351085 2013 Tethering complexes in the endocytic pathway: CORVET and HOPS.
23322049 2013 hVps41 and VAMP7 function in direct TGN to late endosome transport of lysosomal membrane proteins.
More...