Property Summary

NCBI Gene PubMed Count 48
PubMed Score 186.51
PubTator Score 152.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.300 1.4e-02
ependymoma 1.500 8.2e-03
osteosarcoma -1.096 6.4e-03
ovarian cancer 2.500 2.0e-08
psoriasis 1.300 3.2e-04

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (22)

AA Sequence

MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDALTRKKPAKAES      1 - 70
KSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPVSRFFEEVNDPAKNDALEMVEETTWQGLKELG     71 - 140
AFGLQVPSELGGVGLCNTQYARLVEIVGMHDLGVGITLGAHQSIGFKGILLFGTKAQKEKYLPKLASGET    141 - 210
VAAFCLTEPSSGSDAASIRTSAVPSPCGKYYTLNGSKLWISNGGLADIFTVFAKTPVTDPATGAVKEKIT    211 - 280
AFVVERGFGGITHGPPEKKMGIKASNTAEVFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFGMAAALAG    281 - 350
TMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKI    351 - 420
FGSEAAWKVTDECIQIMGGMGFMKEPGVERVLRDLRIFRIFEGTNDILRLFVALQGCMDKGKELSGLGSA    421 - 490
LKNPFGNAGLLLGEAGKQLRRRAGLGSGLSLSGLVHPELSRSGELAVRALEQFATVVEAKLIKHKKGIVN    491 - 560
EQFLLQRLADGAIDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQSDPWQQEL    561 - 630
YRNFKSISKALVERGGVVTSNPLGF                                                 631 - 655
//

Text Mined References (54)

PMID Year Title