Property Summary

NCBI Gene PubMed Count 135
Grant Count 193
R01 Count 148
Funding $26,423,525.74
PubMed Score 233.01
PubTator Score 225.51

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P49736 Q14577 Q15023 Q8N2V1 Q969W7 Q96AE1 Q9BRM7
Symbols BM28
CCNL1
CDCL1
cdc19
DFNA70
D3S3194
MITOTIN

Gene

PDB

5BNX   5BO0   5BNV   5JA4   5C3I   4UUZ  

Gene RIF (85)

PMID Text
26889980 MCM2 expression is higher in ovarian and endometrial high-grade serous carcinomas (HGSC) than in ovarian or endometrial endometrioid carcinoma. Knockdown in ovarian HGSC cell line decreased cell proliferation.
26712671 The findings indicated that Mcm-2 could be a useful marker for early detection of oral squamous cell carcinoma
26549452 PTEN regulates DNA replication through MCM2 and loss of PTEN function leads to replication defects and genomic instability.
26196677 MCM2 is a novel gene responsible for nonsyndromic hearing loss of autosomal dominant inheritance in a Chinese family.
26186914 quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
26167883 Data indicate that minichromosome maintenance protein 2 (MCM2) binding is not required for incorporation of histone H3.1-H4 into chromatin but is important for stability of H3.1-H4.
25755789 minichromosome maintenance protein-2 may serve as a useful marker in the screening of cervical carcinoma and precancerous lesions and improve the diagnosis of atypical squamous cell of undetermined significance
25738322 MCM2 may be a novel therapeutic target of lovastatin treatment in NSCLCs.
25618846 Thermodynamic analysis of the quaternary complex together with structural modeling support that ASF1 and MCM2 could form a chaperoning module for histones H3 and H4 protecting them from promiscuous interactions.
25046975 Results show that in Glioma patients, MCM 2, MCM3 and MCM7 mRNA are up-regulated and correlated with poor outcome.
More...

AA Sequence

MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTEGPLEEEEDGE      1 - 70
ELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQRDREAGRGLGRMRRGLLYDSD     71 - 140
EEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGHSVREWVSMAGPRLEIHHRFKNFLRTHVDSH    141 - 210
GHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNH    211 - 280
IHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPG    281 - 350
SCPECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN    351 - 420
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHED    421 - 490
IKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYV    491 - 560
QRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAA    561 - 630
NPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGS    631 - 700
AAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESM    701 - 770
IRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV    771 - 840
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF          841 - 904
//

Text Mined References (153)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26889980 2016 Similar protein expression profiles of ovarian and endometrial high-grade serous carcinomas.
26712671 2015 Minichromosome maintenance-2 (MCM2) expression differentiates oral squamous cell carcinoma from pre-cancerous lesions.
26549452 2015 PTEN Controls the DNA Replication Process through MCM2 in Response to Replicative Stress.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26196677 2015 Whole Exome Sequencing Identified MCM2 as a Novel Causative Gene for Autosomal Dominant Nonsyndromic Deafness in a Chinese Family.
26186914 2015 Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2.
26167883 2015 A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
25755789 2015 Diagnostic value of MCM2 immunocytochemical staining in cervical lesions and its relationship with HPV infection.
25738322 2015 MCM2 is a therapeutic target of lovastatin in human non-small cell lung carcinomas.
More...