Property Summary

Ligand Count 32
NCBI Gene PubMed Count 55
PubMed Score 4.72
PubTator Score 2.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.6e-06
Breast cancer 1.300 5.9e-08
diabetes mellitus -1.400 1.6e-03
glioblastoma 1.400 5.7e-05
invasive ductal carcinoma 1.100 3.4e-04
lung carcinoma 1.200 3.0e-12
malignant mesothelioma 3.200 5.2e-05
medulloblastoma, large-cell 1.400 2.2e-04
non primary Sjogren syndrome sicca 1.300 3.7e-02
osteosarcoma 2.422 6.5e-07
ovarian cancer 2.900 1.9e-07

Gene RIF (26)

AA Sequence

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMR      1 - 70
NGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTL     71 - 140
SILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS             141 - 201
//

Text Mined References (70)

PMID Year Title