Property Summary

NCBI Gene PubMed Count 53
PubMed Score 2.94
PubTator Score 6.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.900 1.1e-03
glioblastoma 1.400 1.4e-03
Multiple myeloma 1.533 4.3e-03
ovarian cancer 2.400 1.6e-07
Waldenstrons macroglobulinemia 1.252 1.5e-02

Gene RIF (24)

AA Sequence

MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFR      1 - 70
LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSG     71 - 140
TCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD         141 - 205
//

Text Mined References (68)

PMID Year Title