Property Summary

NCBI Gene PubMed Count 67
Grant Count 125
R01 Count 87
Funding $14,794,009.32
PubMed Score 301.63
PubTator Score 184.86

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P49716 Q14937 Q2M2X9 C/EBP delta
Symbols CELF
CRP3
C/EBP-delta
NF-IL6-beta

Gene

PANTHER Protein Class (1)

Gene RIF (57)

PMID Text
26358750 Results suggest that CCAAT/enhancer binding protein delta (CEBPD) could be a useful diagnostic marker and therapeutic target in hepatocellular carcinoma (HCC).
26307680 CEBPD amplification and overexpression is associated with urothelial carcinoma.
26270987 HIV-1 Vpr involves the CEBPD (C/EBP-delta) transcription factor in the induction of CXCL8 (IL8) in astrocytes
26270987 HIV-1 Vpr involves the CEBPD (C/EBP-delta) transcription factor in the induction of CXCL8 (IL8) in astrocytes
26174226 the C/EBPD binding site is required for RU486-mediated activation of the CHOP promoter.
26166618 Knock-down of C/EBPdelta expression in pericytes following immune stimulation increased chemokine and adhesion molecule expression.
25771860 Data indicate that dysfunction of the Rho-associated kinase 2 (Rock2)-p-GSK3beta/beta-catenin-CCAAT/enhancer-binding protein delta (CEBPD) regulatory circuitry may contribute to the tumorigenic characteristic of hepatocellular carcinoma (HCC).
25692954 We have discovered the CEBPD-hypoxia-inducible factor-1 (HIF-1) pathway as a new HIF-1-regulating fundamental mechanism in tubular epithelial cells for the cellular protection against kidney injury.
25680545 Authors found that CK2 bound to C/EBPdelta, which might help to target CK2 to the transcriptional machinery where it can phosphorylate other transcription factors or co-activators.
24667918 HIV-1 Vpr involves the CEBPD (C/EBP-delta) transcription factor in the induction of CXCL8 (IL8) in astrocytes
More...

AA Sequence

MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAA      1 - 70
VPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVA     71 - 140
ACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRD    141 - 210
KAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR               211 - 269
//

Text Mined References (69)

PMID Year Title
26358750 2015 HMDB and 5-AzadC Combination Reverses Tumor Suppressor CCAAT/Enhancer-Binding Protein Delta to Strengthen the Death of Liver Cancer Cells.
26307680 2015 CEBPD amplification and overexpression in urothelial carcinoma: a driver of tumor metastasis indicating adverse prognosis.
26174226 2016 RU486 Induces Pro-Apoptotic Endoplasmic Reticulum Stress Through the Induction of CHOP Expression by Enhancing C/EBP? Expression in Human Renal Carcinoma Caki Cells.
26166618 2015 An anti-inflammatory role for C/EBP? in human brain pericytes.
25771860 2015 ROCK2 promotes HCC proliferation by CEBPD inhibition through phospho-GSK3?/?-catenin signaling.
25692954 2015 Inflammation and hypoxia linked to renal injury by CCAAT/enhancer-binding protein ?.
25680545 2015 CK2 phosphorylation of C/EBP? regulates its transcription factor activity.
24155666 2013 The many faces of C/EBP? and their relevance for inflammation and cancer.
24128855 2013 Isoniazid suppresses antioxidant response element activities and impairs adipogenesis in mouse and human preadipocytes.
23993701 2014 Glycogen synthase kinase-3?-mediated CCAAT/enhancer-binding protein delta phosphorylation in astrocytes promotes migration and activation of microglia/macrophages.
More...