Property Summary

NCBI Gene PubMed Count 71
PubMed Score 299.92
PubTator Score 184.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy 2.128 2.5e-04
adrenocortical carcinoma -1.113 6.0e-03
astrocytoma 1.200 1.8e-10
Astrocytoma, Pilocytic 1.100 8.0e-05
atypical teratoid/rhabdoid tumor -1.200 2.6e-03
breast carcinoma -1.100 3.9e-04
chronic lymphosyte leukemia -2.600 9.3e-15
colon cancer -1.200 2.4e-02
glioblastoma 2.000 2.4e-04
group 3 medulloblastoma -1.700 4.7e-04
inflammatory breast cancer -1.300 1.1e-02
intraductal papillary-mucinous adenoma (... -1.500 8.1e-04
intraductal papillary-mucinous carcinoma... -1.800 8.7e-04
intraductal papillary-mucinous neoplasm ... -1.300 4.4e-03
invasive ductal carcinoma -1.119 5.8e-04
juvenile dermatomyositis 1.499 1.1e-05
lung cancer -2.400 7.9e-06
lung carcinoma -1.300 1.4e-18
malignant mesothelioma 1.100 2.6e-05
medulloblastoma, large-cell -2.100 9.6e-05
non diabetic and post-ischemic heart fai... -1.100 2.0e-03
ovarian cancer -1.600 1.7e-03
pituitary cancer -3.200 6.6e-10
psoriasis 2.000 6.0e-05
subependymal giant cell astrocytoma 1.472 1.8e-02
ulcerative colitis 1.500 9.2e-09

Gene RIF (60)

AA Sequence

MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAA      1 - 70
VPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVA     71 - 140
ACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRD    141 - 210
KAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR               211 - 269
//

Text Mined References (73)

PMID Year Title