Property Summary

NCBI Gene PubMed Count 67
PubMed Score 301.63
PubTator Score 184.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
glioblastoma multiforme 347 2.68348287471743E-27
lung carcinoma 2844 1.41992332669415E-18
chronic lymphosyte leukemia 232 9.30027641619924E-15
pituitary cancer 1972 6.63302556563453E-10
ulcerative colitis 2087 9.23785860108061E-9
lung cancer 4473 1.21674649313285E-6
group 4 medulloblastoma 1875 2.0291337211218E-6
ovarian cancer 8492 6.09784934123485E-6
juvenile dermatomyositis 1189 1.14055042295666E-5
malignant mesothelioma 3163 2.61301592690868E-5
pilocytic astrocytoma 3086 5.89522423922278E-5
psoriasis 6685 5.97092811461864E-5
medulloblastoma, large-cell 6234 9.63339291898006E-5
acute quadriplegic myopathy 1157 2.51848158187928E-4
breast carcinoma 1614 3.93113145629474E-4
invasive ductal carcinoma 2950 5.75589563313064E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 8.13938589474793E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.66779807320483E-4
non diabetic and post-ischemic heart failure 200 0.00199285731265705
atypical teratoid/rhabdoid tumor 1095 0.00260172863303757
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00444919960606308
adrenocortical carcinoma 1427 0.00596207291946542
inflammatory breast cancer 404 0.0108767072438446
astrocytoma 1493 0.0123582073132174
subependymal giant cell astrocytoma 2287 0.0180715594669793
colon cancer 1475 0.0239100429760558

Expression

Synonym

Accession P49716 Q14937 Q2M2X9 C/EBP delta
Symbols CELF
CRP3
C/EBP-delta
NF-IL6-beta

Gene

PANTHER Protein Class (1)

  Ortholog (5)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (56)

PMID Text
26358750 Results suggest that CCAAT/enhancer binding protein delta (CEBPD) could be a useful diagnostic marker and therapeutic target in hepatocellular carcinoma (HCC).
26307680 CEBPD amplification and overexpression is associated with urothelial carcinoma.
26270987 HIV-1 Vpr involves the CEBPD (C/EBP-delta) transcription factor in the induction of CXCL8 (IL8) in astrocytes
26174226 the C/EBPD binding site is required for RU486-mediated activation of the CHOP promoter.
26166618 Knock-down of C/EBPdelta expression in pericytes following immune stimulation increased chemokine and adhesion molecule expression.
25771860 Data indicate that dysfunction of the Rho-associated kinase 2 (Rock2)-p-GSK3beta/beta-catenin-CCAAT/enhancer-binding protein delta (CEBPD) regulatory circuitry may contribute to the tumorigenic characteristic of hepatocellular carcinoma (HCC).
25692954 We have discovered the CEBPD-hypoxia-inducible factor-1 (HIF-1) pathway as a new HIF-1-regulating fundamental mechanism in tubular epithelial cells for the cellular protection against kidney injury.
25680545 Authors found that CK2 bound to C/EBPdelta, which might help to target CK2 to the transcriptional machinery where it can phosphorylate other transcription factors or co-activators.
24667918 HIV-1 Vpr involves the CEBPD (C/EBP-delta) transcription factor in the induction of CXCL8 (IL8) in astrocytes
24155666 Review article on CEBPD expression, regulation and function with focus on inflammation and cancer.
More...

AA Sequence

MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAA      1 - 70
VPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVA     71 - 140
ACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRD    141 - 210
KAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR               211 - 269
//

Text Mined References (69)

PMID Year Title
26358750 2015 HMDB and 5-AzadC Combination Reverses Tumor Suppressor CCAAT/Enhancer-Binding Protein Delta to Strengthen the Death of Liver Cancer Cells.
26307680 2015 CEBPD amplification and overexpression in urothelial carcinoma: a driver of tumor metastasis indicating adverse prognosis.
26174226 2016 RU486 Induces Pro-Apoptotic Endoplasmic Reticulum Stress Through the Induction of CHOP Expression by Enhancing C/EBP? Expression in Human Renal Carcinoma Caki Cells.
26166618 2015 An anti-inflammatory role for C/EBP? in human brain pericytes.
25771860 2015 ROCK2 promotes HCC proliferation by CEBPD inhibition through phospho-GSK3?/?-catenin signaling.
25692954 2015 Inflammation and hypoxia linked to renal injury by CCAAT/enhancer-binding protein ?.
25680545 2015 CK2 phosphorylation of C/EBP? regulates its transcription factor activity.
24155666 2013 The many faces of C/EBP? and their relevance for inflammation and cancer.
24128855 2013 Isoniazid suppresses antioxidant response element activities and impairs adipogenesis in mouse and human preadipocytes.
23993701 2014 Glycogen synthase kinase-3?-mediated CCAAT/enhancer-binding protein delta phosphorylation in astrocytes promotes migration and activation of microglia/macrophages.
More...