Property Summary

NCBI Gene PubMed Count 361
Grant Count 355
R01 Count 193
Funding $39,676,763.32
PubMed Score 757.01
PubTator Score 1065.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
psoriasis 1.200 0.000
astrocytoma 1.900 0.009
glioblastoma 1.500 0.017
autosomal dominant Emery-Dreifuss muscul... 1.257 0.002
acute quadriplegic myopathy 2.271 0.000
tuberculosis 2.100 0.000
lung cancer -1.300 0.002
breast carcinoma -2.000 0.002
fibroadenoma -2.800 0.015
interstitial cystitis -1.300 0.001
group 3 medulloblastoma -1.700 0.000
lung adenocarcinoma 1.300 0.000
ductal carcinoma in situ -2.500 0.001
invasive ductal carcinoma -2.600 0.006
ulcerative colitis -1.100 0.000

Synonym

Accession P49715 A7LNP2 P78319 Q05CA4 C/EBP alpha
Symbols CEBP
C/EBP-alpha

Gene

PANTHER Protein Class (1)

Gene RIF (329)

PMID Text
27131901 The efficient repression of E2F dependent S-phase genes and the activation of differentiation genes reside in the balanced DNA binding capacity of C/EBP alpha.
27050434 results suggested that C/EBPalpha-saRNA successfully inhibited HCC metastasis by inhibiting EGFR/beta-catenin signaling pathway mediated EMT in vitro and in vivo
27005833 Data uncover GCN5 as a negative regulator of C/EBPalpha and demonstrate the importance of C/EBPalpha acetylation in myeloid differentiation.
26847745 Results show that CEBPA in combinations with FLT3 and NPM1 genotype confer favourable prognosis in AML
26823765 C/EBPalpha inhibited breast cancer cell growth via a novel miR-134/CREB signaling pathway.
26722507 C/EBP-alpha was primarily expressed in hepatocytes in normal liver, but its expression decreased significantly in liver fibrosis
26704017 this is the first report on the regulation mechanism of SIRT7 gene, in which, HDAC3 collaborated with C/EBPalpha to occupy its responding element in the upstream region of SIRT7 gene and repressed its expression in human cells.
26679606 These results suggest that the hepatic functions of the human iPS-HLCs could be enhanced by ATF5, c/EBPalpha, and PROX1 transduction.
26537612 In acute myeloid leukemia patients, CEBPA double mutation resulted in a favorable overall survival compared to CEBPA wild-type.
26500142 Reprogramming human B cells into induced pluripotent stem cells and is enhanced by C/EBPa.
More...

AA Sequence

MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDP      1 - 70
AAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLD     71 - 140
GRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQI    141 - 210
AHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDK    211 - 280
NSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSL    281 - 350
VKAMGNCA                                                                  351 - 358
//

Text Mined References (365)

PMID Year Title
27131901 2016 Functional interaction of CCAAT/enhancer-binding-protein-? basic region mutants with E2F transcription factors and DNA.
27050434 2016 C/EBP? Short-Activating RNA Suppresses Metastasis of Hepatocellular Carcinoma through Inhibiting EGFR/?-Catenin Signaling Mediated EMT.
27005833 2016 Acetylation of C/EBP? inhibits its granulopoietic function.
26847745 2016 The value of molecular stratification for CEBPA(DM) and NPM1(MUT) FLT3(WT) genotypes in older patients with acute myeloid leukaemia.
26823765 2015 C/EBP? inhibits proliferation of breast cancer cells via a novel pathway of miR-134/CREB.
26722507 2015 The role of C/EBP-? expression in human liver and liver fibrosis and its relationship with autophagy.
26704017 2016 C/EBP? negatively regulates SIRT7 expression via recruiting HDAC3 to the upstream-promoter of hepatocellular carcinoma cells.
26679606 2016 Hepatic maturation of human iPS cell-derived hepatocyte-like cells by ATF5, c/EBP?, and PROX1 transduction.
26537612 2016 Normal karyotype acute myeloid leukemia patients with CEBPA double mutation have a favorable prognosis but no survival benefit from allogeneic stem cell transplant.
26500142 2016 Reprogramming human B cells into induced pluripotent stem cells and its enhancement by C/EBP?.
More...