Property Summary

NCBI Gene PubMed Count 386
PubMed Score 846.32
PubTator Score 1065.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 2.271 1.6e-09
astrocytoma 1.900 8.5e-03
autosomal dominant Emery-Dreifuss muscul... 1.257 2.3e-03
breast carcinoma -2.000 2.4e-03
ductal carcinoma in situ -2.500 1.4e-03
fibroadenoma -2.800 1.5e-02
glioblastoma 1.500 1.7e-02
group 3 medulloblastoma -1.700 1.6e-06
interstitial cystitis -1.300 7.2e-04
invasive ductal carcinoma -2.600 5.6e-03
lung adenocarcinoma 1.300 1.9e-05
lung cancer -1.300 2.5e-03
malignant mesothelioma 2.100 2.4e-06
psoriasis 1.200 4.9e-04
tuberculosis 2.100 4.2e-08
ulcerative colitis -1.100 8.9e-05

Gene RIF (353)

AA Sequence

MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDP      1 - 70
AAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLD     71 - 140
GRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQI    141 - 210
AHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDK    211 - 280
NSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSL    281 - 350
VKAMGNCA                                                                  351 - 358
//

Text Mined References (394)

PMID Year Title