Property Summary

NCBI Gene PubMed Count 187
Grant Count 406
R01 Count 210
Funding $77,243,466.98
PubMed Score 656.91
PubTator Score 523.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.858 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.002
ovarian cancer -1.500 0.000

Synonym

Accession P49711 B5MC38 Q53XI7 Q59EL8
Symbols MRD21

Gene

PDB

1X6H   2CT1  

Gene RIF (153)

PMID Text
27019336 The action of SNF2H at CTCF sites is functionally important as depletion of CTCF or SNF2H affects transcription of a common group of genes.
26938874 CTCF has a role in regulating SLC45A3-ELK4 Chimeric RNA
26929370 CTCF binds to the provirus at a sharp border in epigenetic modifications in the pX region of the HTLV-1 provirus in T cells naturally infected with HTLV-1. This may cause widespread abnormalities in host cell chromatin structure and gene expression.
26833217 Our data show that aberrant epigenetic inactivation of DUSP2 occurs in carcinogenesis and that CTCF is involved in the epigenetic regulation of DUSP2 expression.
26784546 TGF-beta/beta2-spectrin/CTCF-regulated tumor suppression in human stem cell disorder Beckwith-Wiedemann syndrome.
26747525 Mutational analysis highlighted a potential role for CTCF, a crucial regulator of long-range chromatin interactions, in head and neck cancer progression.
26711177 Here, the authors reveal the methylcytosine dioxygenases TET1 and TET2 as active regulators of CTCF-mediated alternative splicing through conversion of 5-methylcytosine to its oxidation derivatives.
26686651 3D genome simulation suggests a model of chromatin folding around chromosomal axes, where CTCF is involved in defining the interface between condensed and open compartments for structural regulation.
26578602 CSB and CTCF can regulate each other's chromatin association, thereby modulating chromatin structure and coordinating gene expression in response to oxidative stress.
26478432 CTCF negatively regulates HOXA10 expression in breast cancer cells.CTCF flanks important promoter element of HOXA10.
More...

AA Sequence

MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTL      1 - 70
LQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYEN     71 - 140
EVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDPSWQKDPDYQPPAKKTKKTKKS    141 - 210
KLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSN    211 - 280
LDRHMKSHTDERPHKCHLCGRAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKP    281 - 350
FKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG    351 - 420
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHK    421 - 490
NEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKC    491 - 560
GKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKRKMRSKKEDSSDSENAEPDLDDNEDEEEPAV    561 - 630
EIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGE    631 - 700
EEEAQPAATDAPNGDLTPEMILSMMDR                                               701 - 727
//

Text Mined References (196)

PMID Year Title
27019336 2016 The Chromatin Remodelling Enzymes SNF2H and SNF2L Position Nucleosomes adjacent to CTCF and Other Transcription Factors.
26938874 2016 Role of CTCF in Regulating SLC45A3-ELK4 Chimeric RNA.
26929370 2016 The retrovirus HTLV-1 inserts an ectopic CTCF-binding site into the human genome.
26833217 2016 The dual specificity phosphatase 2 gene is hypermethylated in human cancer and regulated by epigenetic mechanisms.
26784546 2016 TGF-?/?2-spectrin/CTCF-regulated tumor suppression in human stem cell disorder Beckwith-Wiedemann syndrome.
26747525 2016 IL-10 and integrin signaling pathways are associated with head and neck cancer progression.
26711177 2016 TET-catalyzed oxidation of intragenic 5-methylcytosine regulates CTCF-dependent alternative splicing.
26686651 2015 CTCF-Mediated Human 3D Genome Architecture Reveals Chromatin Topology for Transcription.
26578602 2016 The CSB chromatin remodeler and CTCF architectural protein cooperate in response to oxidative stress.
26478432 2015 CTCF negatively regulates HOXA10 expression in breast cancer cells.
More...